CARS2 Antibody - #DF14691
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
CARS 2; CysRS; Cysteine tRNA ligase 2; Cysteine tRNA ligase 2 mitochondrial (putative); Cysteine tRNA ligase 2 mitochondrial; Cysteine tRNA ligase; Cysteinyl tRNA synthetase 2; Cysteinyl tRNA synthetase 2 mitochondrial (putative); Cysteinyl tRNA synthetase 2 mitochondrial; DKFZp667A2315; DKFZp686G08243; FLJ12118; OTTHUMP00000018707; Probable cysteine tRNA ligase, mitochondrial; Probable cysteinyl tRNA synthetase mitochondrial;
Immunogens
A synthesized peptide derived from human CARS2.
- Q9HA77 SYCM_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLRTTRGPGLGPPLLQAALGLGRAGWHWPAGRAASGGRGRAWLQPTGRETGVQVYNSLTGRKEPLIVAHAEAASWYSCGPTVYDHAHLGHACSYVRFDIIRRILTKVFGCSIVMVMGITDVDDKIIKRANEMNISPASLASLYEEDFKQDMAALKVLPPTVYLRVTENIPQIISFIEGIIARGNAYSTAKGNVYFDLKSRGDKYGKLVGVVPGPVGEPADSDKRHASDFALWKAAKPQEVFWASPWGPGRPGWHIECSAIASMVFGSQLDIHSGGIDLAFPHHENEIAQCEVFHQCEQWGNYFLHSGHLHAKGKEEKMSKSLKNYITIKDFLKTFSPDVFRFFCLRSSYRSAIDYSDSAMLQAQQLLLGLGSFLEDARAYMKGQLACGSVREAMLWERLSSTKRAVKAALADDFDTPRVVDAILGLAHHGNGQLRASLKEPEGPRSPAVFGAIISYFEQFFETVGISLANQQYVSGDGSEATLHGVVDELVRFRQKVRQFALAMPEATGDARRQQLLERQPLLEACDTLRRGLTAHGINIKDRSSTTSTWELLDQRTKDQKSAG
Research Backgrounds
Mitochondrion matrix.
Belongs to the class-I aminoacyl-tRNA synthetase family.
Research Fields
· Genetic Information Processing > Translation > Aminoacyl-tRNA biosynthesis.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.