ZNF395 Antibody - #DF14677
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
DKFZp434K1210; HD gene regulatory region binding protein 2; HD gene regulatory region-binding protein 2; HD-regulating factor 2; HDBP-2; HDBP2; HDRF-2; Huntington disease gene regulatory region-binding protein 2; Huntington's disease gene regulatory region binding protein 2; Papillomavirus regulatory factor 1; papillomavirus regulatory factor PRF 1; Papillomavirus-binding factor; PBF; PRF-1; PRF1; PTTG1IP; Si-1-8-14; Zinc finger protein 395; ZN395_HUMAN; znf395;
Immunogens
A synthesized peptide derived from human ZNF395.
- Q9H8N7 ZN395_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MASVLSRRLGKRSLLGARVLGPSASEGPSAAPPSEPLLEGAAPQPFTTSDDTPCQEQPKEVLKAPSTSGLQQVAFQPGQKVYVWYGGQECTGLVEQHSWMEGQVTVWLLEQKLQVCCRVEEVWLAELQGPCPQAPPLEPGAQALAYRPVSRNIDVPKRKSDAVEMDEMMAAMVLTSLSCSPVVQSPPGTEANFSASRAACDPWKESGDISDSGSSTTSGHWSGSSGVSTPSPPHPQASPKYLGDAFGSPQTDHGFETDPDPFLLDEPAPRKRKNSVKVMYKCLWPNCGKVLRSIVGIKRHVKALHLGDTVDSDQFKREEDFYYTEVQLKEESAAAAAAAAAGTPVPGTPTSEPAPTPSMTGLPLSALPPPLHKAQSSGPEHPGPESSLPSGALSKSAPGSFWHIQADHAYQALPSFQIPVSPHIYTSVSWAAAPSAACSLSPVRSRSLSFSEPQQPAPAMKSHLIVTSPPRAQSGARKARGEAKKCRKVYGIEHRDQWCTACRWKKACQRFLD
Research Backgrounds
Plays a role in papillomavirus genes transcription.
Cytoplasm. Nucleus.
Note: May shuttle between nucleus and cytoplasm.
Widely expressed.
Interacts with repression-mediating E2 binding site P2 of human papillomavirus type 8 (HPV8).
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.