PTPMT1 Antibody - #DF14604
| Product: | PTPMT1 Antibody |
| Catalog: | DF14604 |
| Description: | Rabbit polyclonal antibody to PTPMT1 |
| Application: | ELISA(peptide) |
| Reactivity: | Human, Mouse, Rat |
| Mol.Wt.: | 23kD(Calculated). |
| Uniprot: | Q8WUK0 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
DUSP23; FLJ46081; MOSP; NB4 apoptosis/differentiation related protein; Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1; Phosphoinositide lipid phosphatase; PLIP; PNAS 129; protein tyrosine phosphatase mitochondrial 1; Protein-tyrosine phosphatase mitochondrial 1; pten like phosphatase; PTEN-like phosphatase; PTPM1_HUMAN; Ptpmt1;
Immunogens
A synthesized peptide derived from human PTPMT1.
- Q8WUK0 PTPM1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAATALLEAGLARVLFYPTLLYTLFRGKVPGRAHRDWYHRIDPTVLLGALPLRSLTRQLVQDENVRGVITMNEEYETRFLCNSSQEWKRLGVEQLRLSTVDMTGIPTLDNLQKGVQFALKYQSLGQCVYVHCKAGRSRSATMVAAYLIQVHKWSPEEAVRAIAKIRSYIHIRPGQLDVLKEFHKQITARATKDGTFVISKT
Research Backgrounds
Lipid phosphatase which dephosphorylates phosphatidylglycerophosphate (PGP) to phosphatidylglycerol (PG) (By similarity). PGP is an essential intermediate in the biosynthetic pathway of cardiolipin, a mitochondrial-specific phospholipid regulating the membrane integrity and activities of the organelle (By similarity). Has also been shown to display phosphatase activity toward phosphoprotein substrates, specifically mediates dephosphorylation of mitochondrial proteins, thereby playing an essential role in ATP production (By similarity). Has probably a preference for proteins phosphorylated on Ser and/or Thr residues compared to proteins phosphorylated on Tyr residues (By similarity). Probably involved in regulation of insulin secretion in pancreatic beta cells (By similarity). May prevent intrinsic apoptosis, probably by regulating mitochondrial membrane integrity.
Mitochondrion inner membrane>Peripheral membrane protein>Matrix side.
Interacts with STYXL1; the interaction inhibits PTPMT1 catalytic activity.
Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.