GUCA1A Antibody - #DF14555
Product: | GUCA1A Antibody |
Catalog: | DF14555 |
Description: | Rabbit polyclonal antibody to GUCA1A |
Application: | ELISA(peptide) |
Reactivity: | Human, Mouse |
Mol.Wt.: | 23kD(Calculated). |
Uniprot: | P43080 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
COD3; GCAP 1; GCAP; Guanylate Cyclase Activating Protein Photoreceptor 1; Guanylate cyclase activator 1A; Guanylin 1; guanylyl cyclase activating protein 1; Guanylyl cyclase-activating protein 1; GUC1A_HUMAN; GUCA; GUCA1; GUCA1A;
Immunogens
A synthesized peptide derived from human GUCA1A.
Retina; cone outer and inner segments, in particular, in disk membrane regions, and to a lesser extent rod inner and outer segments.
- P43080 GUC1A_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGNVMEGKSVEELSSTECHQWYKKFMTECPSGQLTLYEFRQFFGLKNLSPSASQYVEQMFETFDFNKDGYIDFMEYVAALSLVLKGKVEQKLRWYFKLYDVDGNGCIDRDELLTIIQAIRAINPCSDTTMTAEEFTDTVFSKIDVNGDGELSLEEFIEGVQKDQMLLDTLTRSLDLTRIVRRLQNGEQDEEGADEAAEAAG
Research Backgrounds
Stimulates retinal guanylyl cyclase when free calcium ions concentration is low and inhibits guanylyl cyclase when free calcium ions concentration is elevated. This Ca(2+)-sensitive regulation of retinal guanylyl cyclase is a key event in recovery of the dark state of rod photoreceptors following light exposure (By similarity). May be involved in cone photoreceptor light response and recovery of response in bright light (By similarity).
Membrane>Lipid-anchor. Cell projection>Cilium>Photoreceptor outer segment.
Note: Subcellular location is not affected by light or dark conditions.
Retina; cone outer and inner segments, in particular, in disk membrane regions, and to a lesser extent rod inner and outer segments.
Binds three calcium ions (via EF-hands 2, 3 and 4) when calcium levels are high. Binds Mg(2+) when calcium levels are low.
Research Fields
· Organismal Systems > Sensory system > Phototransduction.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.