UBE2E1 Antibody - #DF14541
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
UB2E1_HUMAN; UbcH6; Ube2e1; Ubiquitin carrier protein E1; Ubiquitin conjugating enzyme E2E 1 (homologous to yeast UBC4/5); Ubiquitin conjugating enzyme E2E 1; Ubiquitin-conjugating enzyme E2 E1; ubiquitin-conjugating enzyme E2E 1 (UBC4/5 homolog, yeast); Ubiquitin-protein ligase E1;
Immunogens
A synthesized peptide derived from human UBE2E1.
- P51965 UB2E1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSDDDSRASTSSSSSSSSNQQTEKETNTPKKKESKVSMSKNSKLLSTSAKRIQKELADITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYAT
Research Backgrounds
Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. Catalyzes the covalent attachment of ISG15 to other proteins. Mediates the selective degradation of short-lived and abnormal proteins. In vitro also catalyzes 'Lys-48'-linked polyubiquitination.
ISGylation suppresses ubiquitin E2 enzyme activity.
Autoubiquitinated in vitro.
Nucleus.
Interacts with RNF14.
Belongs to the ubiquitin-conjugating enzyme family.
Research Fields
· Genetic Information Processing > Folding, sorting and degradation > Ubiquitin mediated proteolysis. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.