Product: PLA2G5 Antibody
Catalog: DF14501
Description: Rabbit polyclonal antibody to PLA2G5
Application: IF/ICC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 16kD(Calculated).
Uniprot: P39877

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
PLA2G5 Antibody detects endogenous levels of PLA2G5.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline, pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Ca2+ dependent phospholipase A2; Calcium dependent phospholipase A2; Calcium-dependent phospholipase A2; DKFZp686C2294; FRFB; Group V phospholipase A2; GV PLA2; gVPLA2; hVPLA(2); MGC46205; OTTHUMP00000044655; PA2G5_HUMAN; Phosphatidylcholine 2 acylhydrolase; Phosphatidylcholine 2-acylhydrolase 5; Phospholipase A2 group V; PLA2 10; PLA2 G5; PLA2-10; Pla2g5; sPLA2 Type V;

Immunogens

Immunogen:

A synthesized peptide derived from human PLA2G5.

Uniprot:
Gene(ID):
Expression:
P39877 PA2G5_HUMAN:

Heart, placenta and less abundantly, in lung. Detected in the outer and inner plexiform layers of the retina (at protein level).

Sequence:
MKGLLPLAWFLACSVPAVQGGLLDLKSMIEKVTGKNALTNYGFYGCYCGWGGRGTPKDGTDWCCWAHDHCYGRLEEKGCNIRTQSYKYRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKRNLRSYNPQYQYFPNILCS

Research Backgrounds

Function:

PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. This isozyme hydrolyzes more efficiently L-alpha-1-palmitoyl-2-oleoyl phosphatidylcholine than L-alpha-1-palmitoyl-2-arachidonyl phosphatidylcholine, L-alpha-1-palmitoyl-2-arachidonyl phosphatidylethanolamine, or L-alpha-1-stearoyl-2-arachidonyl phosphatidylinositol. May be involved in the production of lung surfactant, the remodeling or regulation of cardiac muscle.

PTMs:

This enzyme lacks one of the seven disulfide bonds found in similar PA2 proteins.

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Heart, placenta and less abundantly, in lung. Detected in the outer and inner plexiform layers of the retina (at protein level).

Family&Domains:

Belongs to the phospholipase A2 family.

Research Fields

· Environmental Information Processing > Signal transduction > Ras signaling pathway.   (View pathway)

· Metabolism > Lipid metabolism > Glycerophospholipid metabolism.

· Metabolism > Lipid metabolism > Ether lipid metabolism.

· Metabolism > Lipid metabolism > Arachidonic acid metabolism.

· Metabolism > Lipid metabolism > Linoleic acid metabolism.

· Metabolism > Lipid metabolism > alpha-Linolenic acid metabolism.

· Metabolism > Global and overview maps > Metabolic pathways.

· Organismal Systems > Circulatory system > Vascular smooth muscle contraction.   (View pathway)

· Organismal Systems > Digestive system > Pancreatic secretion.

· Organismal Systems > Digestive system > Fat digestion and absorption.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.