Product: BEX3 Antibody
Catalog: DF14499
Description: Rabbit polyclonal antibody to BEX3
Application: IHC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 13kD(Calculated).
Uniprot: Q00994

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
BEX3 Antibody detects endogenous levels of BEX3.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline, pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Bex; BEX3; BEX3_HUMAN; Brain expressed X linked 3 (mouse) homolog; brain expressed, X-linked 3; Brain-expressed X-linked gene 3; Brain-expressed X-linked protein 3; DXS6984E; HGR74; NADE; Nerve growth factor receptor (TNFRSF16) associated protein 1; Nerve growth factor receptor associated protein 1; Nerve growth factor receptor-associated protein 1; NGFR-associated protein 1; NGFRAP1; Ovarian granulosa cell 13.0 kDa protein HGR74; ovarian granulosa cell protein (13kD); Ovarian granulosa cell protein; p75NTR associated cell death executor; p75NTR-associated cell death executor; Protein BEX3;

Immunogens

Immunogen:

A synthesized peptide derived from human BEX3.

Uniprot:
Gene(ID):
Expression:
Q00994 BEX3_HUMAN:

Found in ovarian granulosa cells, testis, prostate and seminal vesicle tissue. High levels also detected in liver.

Sequence:
MANIHQENEEMEQPMQNGEEDRPLGGGEGHQPAGNRRGQARRLAPNFRWAIPNRQINDGMGGDGDDMEIFMEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEFCLMP

Research Backgrounds

Function:

May be a signaling adapter molecule involved in p75NTR-mediated apoptosis induced by NGF. Plays a role in zinc-triggered neuronal death (By similarity). May play an important role in the pathogenesis of neurogenetic diseases.

PTMs:

Ubiquitinated. Degraded by the proteasome (By similarity).

Subcellular Location:

Nucleus. Cytoplasm.
Note: Shuttles between the cytoplasm and the nucleus. Associates with replicating mitochondria (By similarity).

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Found in ovarian granulosa cells, testis, prostate and seminal vesicle tissue. High levels also detected in liver.

Subunit Structure:

Self-associates. Binds to the DEATH domain of p75NTR/NGFR. Interacts with 14-3-3 epsilon (YWHAE). Interacts with DIABLO/SMAC.

Family&Domains:

The nuclear export signal is required for export from the nucleus and the interactions with itself and p75NTR/NGFR.

Belongs to the BEX family.

Research Fields

· Organismal Systems > Nervous system > Neurotrophin signaling pathway.   (View pathway)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.