SKAP1 Antibody - #DF14497
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
pp55; SCAP 1; SCAP1; SKAP 1; SKAP 55; SKAP-55; Skap1; SKAP1_HUMAN; SKAP55 adaptor protein; SRC family associated phosphoprotein 1; Src family-associated phosphoprotein 1; Src kinase associated phosphoprotein 1; SRC kinase associated phosphoprotein 55 kD; Src kinase associated phosphoprotein of 55 kDa; Src kinase-associated phosphoprotein 1; Src kinase-associated phosphoprotein of 55 kDa;
Immunogens
A synthesized peptide derived from human SKAP1.
Highly expressed in thymocytes and peripheral blood lymphocytes. Also expressed in spleen cells and testis. Present in T-cells (at protein level).
- Q86WV1 SKAP1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MQAAALPEEIRWLLEDAEEFLAEGLRNENLSAVARDHRDHILRGFQQIKARYYWDFQPQGGDIGQDSSDDNHSGTLGLSLTSDAPFLSDYQDEGMEDIVKGAQELDNVIKQGYLEKKSKDHSFFGSEWQKRWCVVSRGLFYYYANEKSKQPKGTFLIKGYGVRMAPHLRRDSKKESCFELTSQDRRSYEFTATSPAEARDWVDQISFLLKDLSSLTIPYEEDEEEEEKEETYDDIDGFDSPSCGSQCRPTILPGSVGIKEPTEEKEEEDIYEVLPDEEHDLEEDESGTRRKGVDYASYYQGLWDCHGDQPDELSFQRGDLIRILSKEYNMYGWWVGELNSLVGIVPKEYLTTAFEVEER
Research Backgrounds
Positively regulates T-cell receptor signaling by enhancing the MAP kinase pathway. Required for optimal conjugation between T-cells and antigen-presenting cells by promoting the clustering of integrin ITGAL on the surface of T-cells. May be involved in high affinity immunoglobulin epsilon receptor signaling in mast cells.
Phosphorylated on tyrosines. Phosphorylation by FYN on Tyr-271 is required for GRB2 interaction. Phosphorylation by FYN on Tyr-295 abolishes interaction with FYB1. Tyr-232 is dephosphorylated by PTPRC (Probable).
Cytoplasm. Nucleus. Cell membrane.
Note: Upon T-cell stimulation, translocates to lipid rafts at the cell membrane.
Highly expressed in thymocytes and peripheral blood lymphocytes. Also expressed in spleen cells and testis. Present in T-cells (at protein level).
Homodimer. Interacts with FYN. Interacts with PTPRC. Interacts with GRB2 when phosphorylated on Tyr-271. Interacts with FYB1, which is required for SKAP2 protein stability. Part of a complex consisting of SKAP1, FYB1 and CLNK (By similarity). Interacts with RASGRP1. Interacts with FYB2.
The SH3 domain interacts with FYB1.
Belongs to the SKAP family.
Research Fields
· Environmental Information Processing > Signal transduction > Rap1 signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.