HSPBP1 Antibody - #DF14488
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
1500019G21Rik; FES1; Heat shock protein 70 binding protein; Heat shock protein 70 interacting protein; Heat shock protein binding protein 1; Heat shock protein-binding protein 1; Heat-shock 70-KD protein-binding protein 1; HPBP1_HUMAN; Hsp 70 binding protein; Hsp 70 interacting protein; Hsp70 binding protein 1; Hsp70 binding protein 2; Hsp70 interacting protein 1; Hsp70 interacting protein 2; Hsp70-binding protein 1; Hsp70-binding protein 2; Hsp70-interacting protein 1; Hsp70-interacting protein 2; HSPA (heat shock 70kDa) binding protein, cytoplasmic cochaperone 1; HSPA-binding protein 1; HSPBP; HspBP1; HspBP2; PP1845;
Immunogens
A synthesized peptide derived from human HSPBP1.
- Q9NZL4 HPBP1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSDEGSRGSRLPLALPPASQGCSSGGGGGGSSAGGSGNSRPPRNLQGLLQMAITAGSEEPDPPPEPMSEERRQWLQEAMSAAFRGQREEVEQMKSCLRVLSQPMPPTAGEAEQAADQQEREGALELLADLCENMDNAADFCQLSGMHLLVGRYLEAGAAGLRWRAAQLIGTCSQNVAAIQEQVLGLGALRKLLRLLDRDACDTVRVKALFAISCLVREQEAGLLQFLRLDGFSVLMRAMQQQVQKLKVKSAFLLQNLLVGHPEHKGTLCSMGMVQQLVALVRTEHSPFHEHVLGALCSLVTDFPQGVRECREPELGLEELLRHRCQLLQQHEEYQEELEFCEKLLQTCFSSPADDSMDR
Research Backgrounds
Inhibits HSPA1A chaperone activity by changing the conformation of the ATP-binding domain of HSPA1A and interfering with ATP binding. Interferes with ubiquitination mediated by STUB1 and inhibits chaperone-assisted degradation of immature CFTR.
Ubiquitous.
Interacts with the ATP-binding domain of HSPA1A. Detected in a ternary complex containing STUB1, HSPA1A and HSPBP1.
Research Fields
· Genetic Information Processing > Folding, sorting and degradation > Protein processing in endoplasmic reticulum. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.