GCSAM Antibody - #DF14457
| Product: | GCSAM Antibody |
| Catalog: | DF14457 |
| Description: | Rabbit polyclonal antibody to GCSAM |
| Application: | ELISA(peptide) |
| Reactivity: | Human |
| Mol.Wt.: | 21kD(Calculated). |
| Uniprot: | Q8N6F7 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
GCAT2; Gcet; GCET2 germinal center expressed transcript 2; GCET2 germinal centre expressed transcript 2; Gcsam; GCSAM_HUMAN; Germinal center associated lymphoma; Germinal center associated lymphoma protein; Germinal center B cell associated protein 2; Germinal center B-cell-expressed transcript 2 protein; Germinal center expressed transcript 2; Germinal center-associated lymphoma protein; Germinal center-associated signaling and motility protein; Germinal centre associated lymphoma; Germinal centre associated lymphoma protein; Germinal centre B cell associated protein 2; Germinal centre expressed transcript 2; hGAL; M17; M17 L;
Immunogens
A synthesized peptide derived from human GCSAM.
Expressed in diffuse large B-cell lymphoma (DLBCL) and several germinal center (GC)-like lymphoma cell lines (at protein level). Highly expressed in normal GC lymphocytes and GC-derived malignancies. Expressed in thymus and spleen.
- Q8N6F7 GCSAM_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGNSLLRENRRQQNTQEMPWNVRMQSPKQRTSRCWDHHIAEGCFCLPWKKILIFEKRQDSQNENERMSSTPIQDNVDQTYSEELCYTLINHRVLCTRPSGNSAEEYYENVPCKAERPRESLGGTETEYSLLHMPSTDPRHARSPEDEYELLMPHRISSHFLQQPRPLMAPSETQFSHL
Research Backgrounds
Involved in the negative regulation of lymphocyte motility. It mediates the migration-inhibitory effects of IL6. Serves as a positive regulator of the RhoA signaling pathway. Enhancement of RhoA activation results in inhibition of lymphocyte and lymphoma cell motility by activation of its downstream effector ROCK. Is a regulator of B-cell receptor signaling, that acts through SYK kinase activation.
Phosphorylation on tyrosine residues can be induced by IL6. Phosphorylation is mediated by LYN.
Cytoplasm. Cell membrane.
Note: It relocalizes from the cytoplasm to podosome-like structures upon cell treatment with IL6.
Expressed in diffuse large B-cell lymphoma (DLBCL) and several germinal center (GC)-like lymphoma cell lines (at protein level). Highly expressed in normal GC lymphocytes and GC-derived malignancies. Expressed in thymus and spleen.
Interacts with ACTB and MYH2; the interaction with MYH2 is increased by IL6-induced phosphorylation. Interacts (via C-terminus) with ARHGEF11 (via DH domain). Interacts with ARHGEF12. Interacts with SYK; the interaction increases after B-cell receptor stimulation, resulting in enhanced SYK autophosphorylation and activity.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.