KLRG1 Antibody - #DF14448
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
2F1 Ag; 2F1; C type lectin domain family 15 member A; C-type lectin domain family 15 member A; CLEC15A; ITIM containing receptor MAFA L; ITIM-containing receptor MAFA-L; Killer cell lectin like receptor G1; Killer cell lectin like receptor subfamily G member 1; Killer cell lectin-like receptor subfamily G member 1; KLRG 1; KLRG1; KLRG1 protein; KLRG1_HUMAN; MAFA 2F1; MAFA; MAFA L; MAFA like; MAFA like receptor; MAFA-like receptor; MAFAL; Mast cell function associated antigen (ITIM containing); Mast cell function associated antigen; Mast cell function-associated antigen 2F1; Mast cell function-associated antigen; Mast cell function-associated antigen, rat, homolog of; MGC13600;
Immunogens
A synthesized peptide derived from Human KLRG1.
Expressed specifically on natural killer (NK) cells and T-cells, mainly CD8 T-cells.
- Q96E93 KLRG1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTDSVIYSMLELPTATQAQNDYGPQQKSSSSRPSCSCLVAIALGLLTAVLLSVLLYQWILCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSEAFCWIGLRNNSGWRWEDGSPLNFSRISSNSFVQTCGAINKNGLQASSCEVPLHWVCKKCPFADQALF
Research Backgrounds
Plays an inhibitory role on natural killer (NK) cells and T-cell functions upon binding to their non-MHC ligands. May mediate missing self recognition by binding to a highly conserved site on classical cadherins, enabling it to monitor expression of E-cadherin/CDH1, N-cadherin/CDH2 and R-cadherin/CDH4 on target cells.
Cell membrane>Single-pass type II membrane protein.
Expressed specifically on natural killer (NK) cells and T-cells, mainly CD8 T-cells.
Forms a monomer and homodimer; disulfide-linked. Interacts (via ITIM motif) with PTPN11 and INPP5D.
Contains 1 copy of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. Upon phosphorylation of ITIM motif KLRG1 associates with the two phosphatases PTPN11 and INPP5D (By similarity).
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.