MECR Antibody - #DF14394
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
AI195831; CGI 63; FASN2B; Homolog of yeast 2 enoyl thioester reductase; HsNrbf-1; HsNrbf1; mecr; MECR_HUMAN; Mitochondrial 2 enoyl thioester reductase; mitochondrial; NRBF 1; NRBF-1; NRBF1; Nuclear receptor binding factor 1; Nuclear receptor-binding factor 1; OTTMUSP00000009996; RP23-13A13.1; Trans 2 enoyl CoA reductase, mitochondrial; Trans-2-enoyl-CoA reductase;
Immunogens
A synthesized peptide derived from Human MECR.
Highly expressed in skeletal and heart muscle. Expressed at lower level in placenta, liver, kidney and pancreas. Weakly or not expressed in lung.
- Q9BV79 MECR_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MWVCSTLWRVRTPARQWRGLLPASGCHGPAASSYSASAEPARVRALVYGHHGDPAKVVELKNLELAAVRGSDVRVKMLAAPINPSDINMIQGNYGFLPELPAVGGNEGVAQVVAVGSNVTGLKPGDWVIPANAGLGTWRTEAVFSEEALIQVPSDIPLQSAATLGVNPCTAYRMLMDFEQLQPGDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDRPDIQKLSDRLKSLGAEHVITEEELRRPEMKNFFKDMPQPRLALNCVGGKSSTELLRQLARGGTMVTYGGMAKQPVVASVSLLIFKDLKLRGFWLSQWKKDHSPDQFKELILTLCDLIRRGQLTAPACSQVPLQDYQSALEASMKPFISSKQILTM
Research Backgrounds
Catalyzes the NADPH-dependent reduction of trans-2-enoyl thioesters in mitochondrial fatty acid synthesis (fatty acid synthesis type II). Fatty acid chain elongation in mitochondria uses acyl carrier protein (ACP) as an acyl group carrier, but the enzyme accepts both ACP and CoA thioesters as substrates in vitro. Has a preference for short and medium chain substrates, including trans-2-hexenoyl-CoA (C6), trans-2-decenoyl-CoA (C10), and trans-2-hexadecenoyl-CoA (C16).
Mitochondrion.
Cytoplasm. Nucleus.
Highly expressed in skeletal and heart muscle. Expressed at lower level in placenta, liver, kidney and pancreas. Weakly or not expressed in lung.
Homodimer. Isoform 2 interacts with PPARA in the nucleus and increases its activity (By similarity).
Belongs to the zinc-containing alcohol dehydrogenase family. Quinone oxidoreductase subfamily.
Research Fields
· Metabolism > Lipid metabolism > Fatty acid elongation.
· Metabolism > Global and overview maps > Metabolic pathways.
· Metabolism > Global and overview maps > Fatty acid metabolism.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.