Product: Cathepsin Z Antibody
Catalog: DF14386
Description: Rabbit polyclonal antibody to Cathepsin Z
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 25kD(cleaved),35kD(pro); 34kD(Calculated).
Uniprot: Q9UBR2

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
Cathepsin Z Antibody detects endogenous levels of total Cathepsin Z.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Carboxypeptidase LB; Cathepsin B2; Cathepsin IV; Cathepsin P; Cathepsin X; Cathepsin X precursor; Cathepsin Y; Cathepsin Z; Cathepsin Z precursor; Cathepsin Z1; CathepsinP; CathepsinX; CathepsinZ; CATZ_HUMAN; CTSX; CTSZ; Cysteine type carboxypeptidase; FLJ17088; Lysosomal carboxypeptidase B; Preprocathepsin P; PreprocathepsinP;

Immunogens

Immunogen:

A synthesized peptide derived from Human Cathepsin Z.

Uniprot:
Gene(ID):
Expression:
Q9UBR2 CATZ_HUMAN:

Widely expressed.

Sequence:
MARRGPGWRPLLLLVLLAGAAQGGLYFRRGQTCYRPLRGDGLAPLGRSTYPRPHEYLSPADLPKSWDWRNVDGVNYASITRNQHIPQYCGSCWAHASTSAMADRINIKRKGAWPSTLLSVQNVIDCGNAGSCEGGNDLSVWDYAHQHGIPDETCNNYQAKDQECDKFNQCGTCNEFKECHAIRNYTLWRVGDYGSLSGREKMMAEIYANGPISCGIMATERLANYTGGIYAEYQDTTYINHVVSVAGWGISDGTEYWIVRNSWGEPWGERGWLRIVTSTYKDGKGARYNLAIEEHCTFGDPIV

Research Backgrounds

Function:

Exhibits carboxy-monopeptidase as well as carboxy-dipeptidase activity. Capable of producing kinin potentiating peptides (By similarity).

Subcellular Location:

Lysosome.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Widely expressed.

Family&Domains:

Belongs to the peptidase C1 family.

Research Fields

· Cellular Processes > Transport and catabolism > Lysosome.   (View pathway)

· Cellular Processes > Cell growth and death > Apoptosis.   (View pathway)

References

1). Single‐cell and spatial analyses reveal the association between gene expression of glutamine synthetase with the immunosuppressive phenotype of APOE+CTSZ+TAM in cancers. Molecular Oncology, 2023 (PubMed: 36587392) [IF=5.0]

Application: IF/ICC    Species: Human    Sample: CRC tissues

Fig. 7 Tissue and cellular distribution of APOE+CTSZ+TAM, GLUL+ cells, and Treg. (A, B) Multiplex immunofluorescence staining of CD68 (green), APOE (red), CTSZ (yellow), GLUL (purple), and DAPI (blue) on CRC tissue section of patient PA2203077 and patient PA2220884, scale bar 20 μm. Left: merged and single‐channel photo of the tissue section. Right: combined channel of CD68/APOE/GLUL and CD68/CTSZ/GLUL on the tissue section. (C, D) Multiplex immunofluorescence staining of CD68 (green), APOE (red), CTSZ (yellow), FOXP3 (purple), and DAPI (blue) on CRC tissue section of patient PA2203077 and patient PA2220884, scale bar 20 μm. Left: Merged and single‐channel photo of the tissue section. Right: Combined channel of CD68/APOE/FOXP3 and CD68/CTSZ/FOXP3 on the tissue section. Arrows indicate the representative regions with three immunofluorescence staining.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.