TMEM49 Antibody - #DF14384
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
DKFZP566I133; ectopic P-granules autophagy protein 3 homolog; NF E2 induceble protein 2; NF E2 inducible protein 2; ni 2; protein ni 2; Tango5; TDC1; TMEM49; Transmembrane protein 49; transport and golgi organization 5 homolog; Vacuole membrane protein 1; vmp1; VMP1_HUMAN;
Immunogens
A synthesized peptide derived from Human TMEM49.
- Q96GC9 VMP1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAENGKNCDQRRVAMNKEHHNGNFTDPSSVNEKKRREREERQNIVLWRQPLITLQYFSLEILVILKEWTSKLWHRQSIVVSFLLLLAVLIATYYVEGVHQQYVQRIEKQFLLYAYWIGLGILSSVGLGTGLHTFLLYLGPHIASVTLAAYECNSVNFPEPPYPDQIICPDEEGTEGTISLWSIISKVRIEACMWGIGTAIGELPPYFMARAARLSGAEPDDEEYQEFEEMLEHAESAQDFASRAKLAVQKLVQKVGFFGILACASIPNPLFDLAGITCGHFLVPFWTFFGATLIGKAIIKMHIQKIFVIITFSKHIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQGENWLSWMFEKLVVVMVCYFILSIINSMAQSYAKRIQQRLNSEEKTK
Research Backgrounds
Stress-induced protein that, when overexpressed, promotes formation of intracellular vacuoles followed by cell death. May be involved in the cytoplasmic vacuolization of acinar cells during the early stage of acute pancreatitis. Plays a role in the initial stages of the autophagic process through its interaction with BECN1 (By similarity). Involved in cell-cell adhesion. Plays an essential role in formation of cell junctions. Required for autophagosome formation.
Endoplasmic reticulum-Golgi intermediate compartment membrane>Multi-pass membrane protein. Cell membrane>Multi-pass membrane protein. Vacuole membrane>Multi-pass membrane protein. Endoplasmic reticulum.
Interacts with BECN1 (By similarity). Interacts with TJP1. Interacts with TP53INP2. Interacts with TMEM41B.
The VTT domain was previously called the SNARE-assoc domain. As there is no evidence that this domain associates with SNARE proteins, it was renamed as VMP1, TMEM41, and TVP38 (VTT) domain.
Belongs to the VMP1 family.
Research Fields
· Cellular Processes > Transport and catabolism > Autophagy - animal. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.