PPP1R11 Antibody - #DF14365
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
HCG V; HCG-V; HCGV; Hemochromatosis candidate gene V protein; inhibitor-3; IPP3; protein phosphatase 1 regulatory subunit 11; protein phosphatase 1, regulatory (inhibitor) subunit 11; Protein phosphatase inhibitor 3; t-complex-associated-testis-expressed 5; TCTE5; TCTEX5;
Immunogens
A synthesized peptide derived from Human PPP1R11.
- O60927 PP1RB_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAEAGAGLSETVTETTVTVTTEPENRSLTIKLRKRKPEKKVEWTSDTVDNEHMGRRSSKCCCIYEKPRAFGESSTESDEEEEEGCGHTHCVRGHRKGRRRATLGPTPTTPPQPPDPSQPPPGPMQH
Research Backgrounds
Atypical E3 ubiquitin-protein ligase which ubiquitinates TLR2 at 'Lys-754' leading to its degradation by the proteasome. Plays a role in regulating inflammatory cytokine release and gram-positive bacterial clearance by functioning, in part, through the ubiquitination and degradation of TLR2. Inhibitor of protein phosphatase 1.
Auto-ubiquitinated.
Widely expressed.
Interacts with TLR2 and UBE2D2.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.