Proteasome 20S beta 7 Antibody | Affinity Biosciences

Product:	Proteasome 20S beta 7 Antibody
Catalog:	DF14349
Description:	Rabbit polyclonal antibody to Proteasome 20S beta 7
Application:	ELISA(peptide)
Reactivity:	Human, Mouse, Rat
Mol.Wt.:	30kD(Calculated).
Uniprot:	Q99436

View similar products>>

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific.

Size	Price	Inventory
100ul	$280	In stock
200ul	$350	In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Related Downloads

MS Report

HPLC Report

MSDS

Data Sheet

COA

Protocols

WB Handbook

IHC Protocol

IF/ICC Protocol

Product Info

Source:

Rabbit

Application:

ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:

Human,Mouse,Rat

Clonality:

Polyclonal

Specificity:

Proteasome 20S beta 7 Antibody detects endogenous levels of total Proteasome 20S beta 7.

Conjugate:

Unconjugated.

Purification:

The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).

Storage:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.

Alias:

Fold/Unfold

Macropain chain Z; Multicatalytic endopeptidase complex chain Z; Proteasome (prosome macropain) subunit beta type 7; Proteasome beta 7 subunit; Proteasome catalytic subunit 2; Proteasome subunit alpha; Proteasome subunit beta 7; Proteasome subunit beta type-7; Proteasome subunit Z; PSB7_HUMAN; PSMB7; PUP1; Z;

Immunogens

Immunogen:

A synthesized peptide derived from Human Proteasome 20S beta 7.

Uniprot:

Q99436(PSB7_HUMAN) >>Visit HPA database.

Gene(ID):

PSMB7(5695)

Expression:

Q99436 PSB7_HUMAN:

Expressed at a low level in colonic mucosa. Up-regulated in colorectal cancer tissues.

Sequence:

Q99436 PSB7_HUMAN:
Protein BLAST With
NCBI/
ExPASy/
Uniprot

MAAVSVYAPPVGGFSFDNCRRNAVLEADFAKRGYKLPKVRKTGTTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKNLVSEAIAAGIFNDLGSGSNIDLCVISKNKLDFLRPYTVPNKKGTRLGRYRCEKGTTAVLTEKITPLEIEVLEETVQTMDTS

Research Backgrounds

Q99436_PSB7_HUMAN

Function:

Component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with two 19S regulatory particles, forms the 26S proteasome and thus participates in the ATP-dependent degradation of ubiquitinated proteins. The 26S proteasome plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins that could impair cellular functions, and by removing proteins whose functions are no longer required. Associated with the PA200 or PA28, the 20S proteasome mediates ubiquitin-independent protein degradation. This type of proteolysis is required in several pathways including spermatogenesis (20S-PA200 complex) or generation of a subset of MHC class I-presented antigenic peptides (20S-PA28 complex). Within the 20S core complex, PSMB7 displays a trypsin-like activity.

Subcellular Location:

Cytoplasm. Nucleus.

Tissue Specificity:

Expressed at a low level in colonic mucosa. Up-regulated in colorectal cancer tissues.

Subunit Structure:

The 26S proteasome consists of a 20S proteasome core and two 19S regulatory subunits. The 20S proteasome core is a barrel-shaped complex made of 28 subunits that are arranged in four stacked rings. The two outer rings are each formed by seven alpha subunits, and the two inner rings are formed by seven beta subunits. The proteolytic activity is exerted by three beta-subunits PSMB5, PSMB6 and PSMB7.

(Microbial infection) Interacts with HIV-1 Tat protein.

Family&Domains:

Belongs to the peptidase T1B family.

Research Fields

· Genetic Information Processing > Folding, sorting and degradation > Proteasome.

Restrictive clause

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.

Proteasome 20S beta 7 Antibody - #DF14349