DPM3 Antibody - #DF14332
Product: | DPM3 Antibody |
Catalog: | DF14332 |
Description: | Rabbit polyclonal antibody to DPM3 |
Application: | ELISA(peptide) |
Reactivity: | Human, Mouse, Rat |
Mol.Wt.: | 10kD(Calculated). |
Uniprot: | Q9P2X0 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
CDG1O; Dolichol Phosphate Mannose Synthase subunit 3; Dolichol phosphate mannosyltransferase subunit 3; Dolichyl Phosphate beta D Mannosyltransferase subunit 3; Dolichyl phosphate mannosyltransferase polypeptide 3; DPM synthase complex subunit 3; Mannose P Dolichol Synthase subunit 3; MPD synthase subunit 3; Prostin 1;
Immunogens
A synthesized peptide derived from Human DPM3.
- Q9P2X0 DPM3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTKLAQWLWGLAILGSTWVALTTGALGLELPLSCQEVLWPLPAYLLVSAGCYALGTVGYRVATFHDCEDAARELQSQIQEARADLARRGLRF
Research Backgrounds
Stabilizer subunit of the dolichol-phosphate mannose (DPM) synthase complex; tethers catalytic subunit DPM1 to the ER.
Endoplasmic reticulum membrane>Multi-pass membrane protein.
Component of the dolichol-phosphate mannose (DPM) synthase complex composed of DPM1, DPM2 and DPM3; in the complex associated with DPM1 via its C-terminal domain and with DPM2 via its N-terminal portion.
Belongs to the DPM3 family.
Research Fields
· Metabolism > Glycan biosynthesis and metabolism > N-Glycan biosynthesis.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.