SPRR1a Antibody - #DF14296
Product: | SPRR1a Antibody |
Catalog: | DF14296 |
Description: | Rabbit polyclonal antibody to SPRR1a |
Application: | ELISA(peptide) |
Reactivity: | Human |
Mol.Wt.: | 10~20kD; 10kD(Calculated). |
Uniprot: | P35321 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
19 kDa pancornulin; Cornifin A; Cornifin alpha; CornifinA; Small proline rich protein 1A; Small proline rich protein IA; spr; SPR IA; SPRK; SPRR 1a; SPRR1A protein;
Immunogens
A synthesized peptide derived from Human SPRR1a.
- P35321 SPR1A_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MNSQQQKQPCTPPPQPQQQQVKQPCQPPPQEPCIPKTKEPCHPKVPEPCHPKVPEPCQPKVPEPCQPKVPEPCPSTVTPAPAQQKTKQK
Research Backgrounds
Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane.
Cytoplasm.
Belongs to the cornifin (SPRR) family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.