ATG101 Antibody - #DF14208
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
ATG101; Atg13-interacting protein; ATGA1_HUMAN; Autophagy-related protein 101; C12orf44; Chromosome 12 open reading frame 44; FLJ11773; OTTHUMP00000241687; OTTHUMP00000241688; OTTHUMP00000241689;
Immunogens
A synthesized peptide derived from Human ATG101.
- Q9BSB4 ATGA1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MNCRSEVLEVSVEGRQVEEAMLAVLHTVLLHRSTGKFHYKKEGTYSIGTVGTQDVDCDFIDFTYVRVSSEELDRALRKVVGEFKDALRNSGGDGLGQMSLEFYQKKKSRWPFSDECIPWEVWTVKVHVVALATEQERQICREKVGEKLCEKIINIVEVMNRHEYLPKMPTQSEVDNVFDTGLRDVQPYLYKISFQITDALGTSVTTTMRRLIKDTLAL
Research Backgrounds
Autophagy factor required for autophagosome formation. Stabilizes ATG13, protecting it from proteasomal degradation.
Cytoplasm. Preautophagosomal structure.
Note: Under starvation conditions, it is localized to puncate structures primarily representing the isolation membrane; the isolation membrane sequesters a portion of the cytoplasm resulting in autophagosome formation.
Interacts with ATG13. Associates with a complex composed of ATG13, ULK1 and RB1CC1; the association with this complex requires the presence of ATG13.
Belongs to the ATG101 family.
Research Fields
· Cellular Processes > Transport and catabolism > Autophagy - other. (View pathway)
· Cellular Processes > Transport and catabolism > Autophagy - animal. (View pathway)
· Organismal Systems > Aging > Longevity regulating pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.