NHP2L1 Antibody - #DF14141
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
[U4/U6.U5] tri snRNP; 15.5 kD RNA binding protein; High mobility group like nuclear protein 2 homolog 1; hSNU13; NHP2 non histone chromosome protein 2 like 1 (S. cerevisiae); NHP2L 1; NHP2L1; NHPX; OTK27; SNU13;
Immunogens
A synthesized peptide derived from Human NHP2L1.
- P55769 NH2L1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV
Research Backgrounds
Involved in pre-mRNA splicing as component of the spliceosome. Binds to the 5'-stem-loop of U4 snRNA and thereby contributes to spliceosome assembly. The protein undergoes a conformational change upon RNA-binding.
Nucleus. Nucleus>Nucleolus.
Note: Concentrated in the dense fibrillar component of the nucleolus.
Ubiquitous.
Identified in the spliceosome B complex. Component of the U4/U6-U5 tri-snRNP complex composed of the U4, U6 and U5 snRNAs and at least PRPF3, PRPF4, PRPF6, PRPF8, PRPF31, SNRNP200, TXNL4A, WDR57, SNRNP40, DDX23, CD2BP2, PPIH, NHP2L1, EFTUD2, SART1 and USP39. Interacts with RAD17 and PRPF31. The complex formed by SNU13 and PRPF31 binds U4 snRNA. The complex formed by SNU13 and PRPF31 binds also U4atac snRNA, a characteristic component of specific, less abundant spliceosomal complexes.
Belongs to the eukaryotic ribosomal protein eL8 family.
Research Fields
· Genetic Information Processing > Translation > Ribosome biogenesis in eukaryotes.
· Genetic Information Processing > Transcription > Spliceosome.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.