FAU Antibody - #DF14088
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
40S ribosomal protein S30; asr1; FAU; FAU encoded ubiquitin like protein; FAU1; FBR MuSV associated ubiquitously expressed; Finkel Biskis Reilly murine sarcoma virus (FBR MuSV) ubiquitously expressed (fox derived); Finkel Biskis Reilly murine sarcoma virus (FBR MuSV) ubiquitously expressed; Finkel Biskis Reilly murine sarcoma virus ubiquitously expressed; FLJ22986; Fub1; Fubi; MNSFbeta; Monoclonal nonspecific suppressor factor beta; Ribosomal protein S30; RPS30; S30; UBIM_HUMAN; Ubiquitin like protein fubi and ribosomal protein S30; Ubiquitin like protein fubi; Ubiquitin like S30 fusion protein; Ubiquitin-like protein FUBI;
Immunogens
A synthesized peptide derived from Human FAU.
- P35544 UBIM_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLEDEATLGQCGVEALTTLEVAGRMLGG
Research Backgrounds
Belongs to the ubiquitin family.
Research Fields
· Genetic Information Processing > Translation > Ribosome.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.