PPAP2A Antibody - #DF14024

(1)  
Product: PPAP2A Antibody
Catalog: DF14024
Description: Rabbit polyclonal antibody to PPAP2A
Application: IF/ICC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 32kD; 32kD(Calculated).
Uniprot: O14494

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MS Report
HPLC Report
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
PPAP2A Antibody detects endogenous levels of total PPAP2A.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Lipid phosphate phosphohydrolase 1; Lipid phosphate phosphohydrolase 1a; LLP1a; LPP1; LPP1_HUMAN; PAP 2a; PAP-2a; PAP2; PAP2-alpha; PAP2a; PAP2a2; PAP2alpha2; PAPalpha1; Phosphatidate phosphohydrolase type 2a; Phosphatidic acid phosphatase 2a; Phosphatidic acid phosphatase type 2A; Phosphatidic acid phosphohydrolase type 2a; PPAP2A; Type 2 phosphatidic acid phosphatase alpha; Type 2 phosphatidic acid phosphohydrolase;

Immunogens

Immunogen:

A synthesized peptide derived from Human PPAP2A.

Uniprot:

O14494(PLPP1_HUMAN) >>Visit HPA database.

Gene(ID):
PLPP1(8611)
Expression:
O14494 PLPP1_HUMAN:

Widely expressed with highest expression found in prostate (PubMed:9305923). Found to be down-regulated in colon adenocarcinomas (PubMed:9570154).

Predominant in kidney, lung, placenta and liver.

Predominant in heart and pancreas.

Sequence:
MFDKTRLPYVALDVLCVLLAGLPFAILTSRHTPFQRGVFCNDESIKYPYKEDTIPYALLGGIIIPFSIIVIILGETLSVYCNLLHSNSFIRNNYIATIYKAIGTFLFGAAASQSLTDIAKYSIGRLRPHFLDVCDPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCMLFVALYLQARMKGDWARLLRPTLQFGLVAVSIYVGLSRVSDYKHHWSDVLTGLIQGALVAILVAVYVSDFFKERTSFKERKEEDSHTTLHETPTTGNHYPSNHQP

Research Backgrounds

Function:

Magnesium-independent phospholipid phosphatase of the plasma membrane that catalyzes the dephosphorylation of a variety of glycerolipid and sphingolipid phosphate esters including phosphatidate/PA, lysophosphatidate/LPA, diacylglycerol pyrophosphate/DGPP, sphingosine 1-phosphate/S1P and ceramide 1-phosphate/C1P. Also acts on N-oleoyl ethanolamine phosphate/N-(9Z-octadecenoyl)-ethanolamine phosphate, a potential physiological compound. Through its extracellular phosphatase activity allows both the hydrolysis and the cellular uptake of these bioactive lipid mediators from the milieu, regulating signal transduction in different cellular processes. It is for instance essential for the extracellular hydrolysis of S1P and subsequent conversion into intracellular S1P. Involved in the regulation of inflammation, platelets activation, cell proliferation and migration among other processes. May also have an intracellular activity to regulate phospholipid-mediated signaling pathways (By similarity).

PTMs:

N-glycosylated. N-linked sugars are of the complex type. N-glycosylation is not required for the phosphatase activity (By similarity).

Subcellular Location:

Cell membrane>Multi-pass membrane protein. Apical cell membrane>Multi-pass membrane protein. Membrane raft>Multi-pass membrane protein. Membrane>Caveola>Multi-pass membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Widely expressed with highest expression found in prostate. Found to be down-regulated in colon adenocarcinomas.

Predominant in kidney, lung, placenta and liver.

Predominant in heart and pancreas.

Subunit Structure:

Forms functional homodimers and homooligomers that are not required for substrate recognition and catalytic activity (By similarity). Can also form heterooligomers with PLPP2 and PLPP3 (By similarity).

Family&Domains:

Belongs to the PA-phosphatase related phosphoesterase family.

Research Fields

· Environmental Information Processing > Signal transduction > Phospholipase D signaling pathway.   (View pathway)

· Human Diseases > Cancers: Overview > Choline metabolism in cancer.   (View pathway)

· Metabolism > Lipid metabolism > Glycerolipid metabolism.

· Metabolism > Lipid metabolism > Glycerophospholipid metabolism.

· Metabolism > Lipid metabolism > Ether lipid metabolism.

· Metabolism > Lipid metabolism > Sphingolipid metabolism.

· Metabolism > Global and overview maps > Metabolic pathways.

· Organismal Systems > Immune system > Fc gamma R-mediated phagocytosis.   (View pathway)

· Organismal Systems > Digestive system > Fat digestion and absorption.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.