Product: Acid Phosphatase Antibody
Catalog: DF14023
Source: Rabbit
Application: IHC, IF/ICC, ELISA(peptide)
Reactivity: Human, Mouse, Rat
Mol.Wt.: 18kD(Calculated).
Uniprot: P24666

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
IF/ICC 1:100-1:500, IHC 1:50-1:200, ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
Acid Phosphatase Antibody detects endogenous levels of total Acid Phosphatase.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Acid phosphatase 1 soluble; Acid phosphatase of erythrocyte; ACP1; Adipocyte acid phosphatase; Cytoplasmic phosphotyrosyl protein phosphatase; HAAP; LMW-PTP; LMW-PTPase; Low molecular weight cytosolic acid phosphatase; Low molecular weight phosphotyrosine protein phosphatase; PAP1; PAP2; phosphatase, acid, of erythrocyte; PPAC_HUMAN; Protein tyrosine phosphatase; PTPase; Purple acid phosphatase; Red cell acid phosphatase 1; testicular secretory protein Li 37;

Immunogens

Immunogen:

A synthesized peptide derived from Human Acid Phosphatase.

Uniprot:
Gene(ID):
Expression:
P24666 PPAC_HUMAN:

T-lymphocytes express only isoform 2.

Sequence:
MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH

Research Backgrounds

Function:

Acts on tyrosine phosphorylated proteins, low-MW aryl phosphates and natural and synthetic acyl phosphates. Isoform 3 does not possess phosphatase activity.

Subcellular Location:

Cytoplasm.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

T-lymphocytes express only isoform 2.

Subunit Structure:

Isoform 1 interacts with the SH3 domain of SPTAN1. There is no interaction observed for isoforms 2 or 3. Interacts with EPHA2; dephosphorylates EPHA2. Interacts with EPHB1.

Family&Domains:

Belongs to the low molecular weight phosphotyrosine protein phosphatase family.

Research Fields

· Cellular Processes > Cellular community - eukaryotes > Adherens junction.   (View pathway)

· Metabolism > Metabolism of cofactors and vitamins > Thiamine metabolism.

· Metabolism > Metabolism of cofactors and vitamins > Riboflavin metabolism.

· Metabolism > Global and overview maps > Metabolic pathways.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.