IMPA1 Antibody - #DF13947
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
IMP 1; IMP; IMPA 1; IMPA; IMPA1; IMPA1_HUMAN; IMPase 1; IMPase; Inositol 1(or 4) monophosphatase; Inositol monophosphatase 1; Inositol monophosphatase; Inositol(myo) 1(or 4) monophosphatase 1; Inositol-1(or 4)-monophosphatase 1; Lithium sensitive myo inositol monophosphatase A1; Lithium-sensitive myo-inositol monophosphatase A1;
Immunogens
A synthesized peptide derived from Human IMPA1.
- P29218 IMPA1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MADPWQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDED
Research Backgrounds
Responsible for the provision of inositol required for synthesis of phosphatidylinositol and polyphosphoinositides and has been implicated as the pharmacological target for lithium action in brain. Has broad substrate specificity and can use myo-inositol monophosphates, myo-inositol 1,3-diphosphate, myo-inositol 1,4-diphosphate, scyllo-inositol-phosphate, D-galactose 1-phosphate, glucose-1-phosphate, glucose-6-phosphate, fructose-1-phosphate, beta-glycerophosphate, and 2'-AMP as substrates.
Cytoplasm.
Homodimer.
Belongs to the inositol monophosphatase superfamily.
Research Fields
· Environmental Information Processing > Signal transduction > Phosphatidylinositol signaling system.
· Metabolism > Carbohydrate metabolism > Inositol phosphate metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.