TGF beta induced factor 2 Antibody - #DF13939
| Product: | TGF beta induced factor 2 Antibody | 
| Catalog: | DF13939 | 
| Description: | Rabbit polyclonal antibody to TGIF2 | 
| Application: | ELISA(peptide) | 
| Reactivity: | Human, Mouse, Rat | 
| Mol.Wt.: | 27kD; 26kD(Calculated). | 
| Uniprot: | Q9GZN2 | 
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
5' TG 3' interacting factor 2; 5''-TG-3''-interacting factor 2; Homeobox protein TGIF2; TGF (beta) induced transcription factor 2; TGF beta induced factor 2; TGF-beta-induced transcription factor 2; TGFB induced factor 2; TGFB-induced factor 2; Tgif2; TGIF2_HUMAN; Transforming growth factor beta induced factor 2;
Immunogens
A synthesized peptide derived from Human TGIF2.
Widely expressed. Highly expressed in heart, kidney and testis. Weakly expressed in brain and prostate.
- Q9GZN2 TGIF2_HUMAN:
 - Protein BLAST With
 - NCBI/
 - ExPASy/
 - Uniprot
 
MSDSDLGEDEGLLSLAGKRKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNLSVLQICNWFINARRRLLPDMLRKDGKDPNQFTISRRGGKASDVALPRGSSPSVLAVSVPAPTNVLSLSVCSMPLHSGQGEKPAAPFPRGELESPKPLVTPGSTLTLLTRAEAGSPTGGLFNTPPPTPPEQDKEDFSSFQLLVEVALQRAAEMELQKQQDPSLPLLHTPIPLVSENPQ
Research Backgrounds
Transcriptional repressor, which probably repress transcription by binding directly the 5'-CTGTCAA-3' DNA sequence or by interacting with TGF-beta activated SMAD proteins. Probably represses transcription via the recruitment of histone deacetylase proteins.
The C-terminal part is phosphorylated in response to EGF signaling by the Ras/MAPK pathway.
Nucleus. 
Note: Excluded from nucleoli.
Widely expressed. Highly expressed in heart, kidney and testis. Weakly expressed in brain and prostate.
Belongs to the TALE/TGIF homeobox family.
Research Fields
· Environmental Information Processing > Signal transduction > TGF-beta signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.