ATOX1 Antibody - #DF13934
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
ATOX1; ATOX1_HUMAN; ATX1; ATX1 antioxidant protein 1 homolog (yeast); ATX1 antioxidant protein 1 homolog; Copper transport protein; Copper transport protein ATOX1; HAH1; Metal transport protein; Metal transport protein ATX1; MGC138453; MGC138455;
Immunogens
A synthesized peptide derived from Human ATOX1.
- O00244 ATOX1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE
Research Backgrounds
Binds and deliver cytosolic copper to the copper ATPase proteins. May be important in cellular antioxidant defense.
Ubiquitous.
Interacts with ATP7B. Interacts with ATP7A.
Belongs to the ATX1 family.
Research Fields
· Organismal Systems > Digestive system > Mineral absorption.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.