Ascl2 Antibody - #DF13878
Product: | Ascl2 Antibody |
Catalog: | DF13878 |
Description: | Rabbit polyclonal antibody to Ascl2 |
Application: | ELISA(peptide) |
Reactivity: | Human, Mouse, Rat |
Mol.Wt.: | 20kD; 20kD(Calculated). |
Uniprot: | Q99929 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
Achaete scute complex like 2; Achaete scute homolog 2; achaete-scute complex-like 2; Achaete-scute homolog 2; ASCL2; ASCL2_HUMAN; ASH-2; Ash2; bHLHa45; Class A basic helix-loop-helix protein 45; HASH2; Mash2;
Immunogens
A synthesized peptide derived from Human Ascl2.
Expressed specifically in the extravillous trophoblasts of the developing placenta.
- Q99929 ASCL2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDGGTLPRSAPPAPPVPVGCAARRRPASPELLRCSRRRRPATAETGGGAAAVARRNERERNRVKLVNLGFQALRQHVPHGGASKKLSKVETLRSAVEYIRALQRLLAEHDAVRNALAGGLRPQAVRPSAPRGPPGTTPVAASPSRASSSPGRGGSSEPGSPRSAYSSDDSGCEGALSPAERELLDFSSWLGGY
Research Backgrounds
AS-C proteins are involved in the determination of the neuronal precursors in the peripheral nervous system and the central nervous system.
Nucleus.
Expressed specifically in the extravillous trophoblasts of the developing placenta.
Efficient DNA binding requires dimerization with another bHLH protein. Interacts with SETD1A. Part of a complex composed at least of ASCL2, EMSY, HCFC1, HSPA8, CCAR2, MATR3, MKI67, RBBP5, TUBB2A, WDR5 and ZNF335; this complex may have a histone H3-specific methyltransferase activity.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.