p19 INK4d Antibody - #DF13861
Product: | p19 INK4d Antibody |
Catalog: | DF13861 |
Description: | Rabbit polyclonal antibody to p19 INK4d |
Application: | ELISA(peptide) |
Reactivity: | Human, Mouse |
Mol.Wt.: | 19kD; 18kD(Calculated). |
Uniprot: | P55273 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
CDK inhibitor p19INK4d; CDKN2D; cell cycle inhibitor, Nur77 associating protein; Cyclin dependent kinase inhibitor 2D; Cyclin-dependent kinase 4 inhibitor D; Cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4); inhibitor of cyclin-dependent kinase 4d; INK4D; MGC109660; MGC137547; MGC73010; p19; p19-INK4D; p19INK4d; Similar to cyclin-dependent kinase inhibitor 2D;
Immunogens
A synthesized peptide derived from Human p19 INK4d.
- P55273 CDN2D_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGASPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQGHMVAPL
Research Backgrounds
Interacts strongly with CDK4 and CDK6 and inhibits them.
Nucleus. Cytoplasm.
Interacts with CDK6.
Belongs to the CDKN2 cyclin-dependent kinase inhibitor family.
Research Fields
· Cellular Processes > Cell growth and death > Cell cycle. (View pathway)
· Environmental Information Processing > Signal transduction > FoxO signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.