VAPA Antibody - #DF13847
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
33 kDa Vamp-associated protein; hVAP 33; MGC3745; OTTHUMP00000162362; OTTHUMP00000162363; VAMP (vesicle-associated membrane protein) associated protein A, 33kDa; VAMP A; VAMP associated protein A; VAMP-A; VAMP-associated protein A; VAP 33; VAP A; VAP-33; VAP-A; VAP33; Vapa; VAPA_HUMAN; Vesicle associated membrane protein associated protein A; Vesicle-associated membrane protein-associated protein A;
Immunogens
A synthesized peptide derived from Human VAPA.
- Q9P0L0 VAPA_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MASASGAMAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDPGSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASFRDNVTSPLPSLLVVIAAIFIGFFLGKFIL
Research Backgrounds
Binds to OSBPL3, which mediates recruitment of VAPA to plasma membrane sites. The ORP3-VAPA complex stimulates RRAS signaling which in turn attenuates integrin beta-1 (ITGB1) activation at the cell surface. With OSBPL3, may regulate ER morphology. May play a role in vesicle trafficking.
Endoplasmic reticulum membrane>Single-pass type IV membrane protein. Cell membrane>Single-pass type IV membrane protein. Cell junction>Tight junction. Nucleus membrane.
Note: Present in the plasma membrane and in intracellular vesicles, together with SNARE proteins. May also associate with the cytoskeleton. Colocalizes with OCLN at the tight junction in polarized epithelial cells.
Ubiquitous.
Homodimer, and heterodimer with VAPB. Interacts with VAMP1, VAMP2, STX1A, BET1, SEC22C and with the C-terminal domain of OCLN. Interacts with OSBPL1A (By similarity). Interacts (via MSP domain) with ZFYVE27; may retain ZFYVE27 in the endoplasmic reticulum and regulate its function in cell projections formation. Interacts with OSBP. Interacts (via C-terminus) with RSAD2/viperin (via C-terminus). Interacts with IFITM3. Interacts with OSBPL3 (phosphorylated form). Interacts with KIF5A in a ZFYVE27-dependent manner. Interacts with STARD3 (via FFAT motif). Interacts with STARD3NL (via FFAT motif). Interacts with CERT1.
(Microbial infection) Interacts with HCV protein NS5A and NS5B.
Belongs to the VAMP-associated protein (VAP) (TC 9.B.17) family.
Research Fields
· Organismal Systems > Digestive system > Cholesterol metabolism.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.