Pit1 Antibody - #DF13833
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
Dwarf; GHF 1; GHF 1A; GHF-1; GHF1; GHF1A; Growth hormone factor 1; Hmp 1; Hmp1; Pit 1; Pit 1 beta; PIT 1Z; PiT-1; Pit1 beta; PIT1_HUMAN; PIT1Z; Pituitary growth hormone; Pituitary specific positive transcription factor 1; Pituitary-specific positive transcription factor 1; POU class 1 homeobox 1; POU domain class 1 transcription factor 1; POU domain transcriptional regulator; POU1F1;
Immunogens
A synthesized peptide derived from Human Pit1.
- P28069 PIT1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSCQAFTSADTFIPLNSDASATLPLIMHHSAAECLPVSNHATNVMSTATGLHYSVPSCHYGNQPSTYGVMAGSLTPCLYKFPDHTLSHGFPPIHQPLLAEDPTAADFKQELRRKSKLVEEPIDMDSPEIRELEKFANEFKVRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSFKNACKLKAILSKWLEEAEQVGALYNEKVGANERKRKRRTTISIAAKDALERHFGEQNKPSSQEIMRMAEELNLEKEVVRVWFCNRRQREKRVKTSLNQSLFSISKEHLECR
Research Backgrounds
Transcription factor involved in the specification of the lactotrope, somatotrope, and thyrotrope phenotypes in the developing anterior pituitary. Specifically binds to the consensus sequence 5'-TAAAT-3'. Activates growth hormone and prolactin genes.
Nucleus.
Interacts with PITX1. Interacts with LHX3. Interacts with ELK1.
Belongs to the POU transcription factor family. Class-1 subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.