ZWINT Antibody - #DF13831
Product: | ZWINT Antibody |
Catalog: | DF13831 |
Description: | Rabbit polyclonal antibody to ZWINT |
Application: | ELISA(peptide) |
Reactivity: | Human |
Mol.Wt.: | 35kD; 31kD(Calculated). |
Uniprot: | O95229 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
Human ZW10 interacting protein 1; HZwint 1; HZwint1; KNTC 2 AP; KNTC2AP; MGC 117174; MGC117174; ZW10 interacting kinetochore protein; ZW10 interacting protein 1; ZW10 interactor; ZW10 interactor, kinetochore protein; ZW10-interacting protein 1; ZWINT 1; ZWINT; Zwint-1; ZWINT_HUMAN; ZWINT1;
Immunogens
A synthesized peptide derived from Human ZWINT.
- O95229 ZWINT_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEAAETEAEAAALEVLAEVAGILEPVGLQEEAELPAKILVEFVVDSQKKDKLLCSQLQVADFLQNILAQEDTAKGLDPLASEDTSRQKAIAAKEQWKELKATYREHVEAIKIGLTKALTQMEEAQRKRTQLREAFEQLQAKKQMAMEKRRAVQNQWQLQQEKHLQHLAEVSAEVRERKTGTQQELDRVFQKLGNLKQQAEQERDKLQRYQTFLQLLYTLQGKLLFPEAEAEAENLPDDKPQQPTRPQEQSTGDTMGRDPGVSFKAVGLQPAGDVNLP
Research Backgrounds
Part of the MIS12 complex, which is required for kinetochore formation and spindle checkpoint activity. Required to target ZW10 to the kinetochore at prometaphase.
Nucleus. Chromosome>Centromere>Kinetochore.
Note: Localizes to kinetochores from late prophase to anaphase.
Interacts with ZW10 and MIS12. Interacts with the NDC80 subunit of the NDC80 complex specifically during mitosis. Also interacts with KNL1, CETN3, DSN1 and PMF1.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.