IL17D Antibody - #DF13823
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
IL 17D; IL 22; IL 27; IL-17D; IL-27; IL17D; IL17D_HUMAN; IL27; Interleukin 17D; Interleukin 27; Interleukin-17D; Interleukin-27;
Immunogens
A synthesized peptide derived from Human IL17D.
- Q8TAD2 IL17D_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLVAGFLLALPPSWAAGAPRAGRRPARPRGCADRPEELLEQLYGRLAAGVLSAFHHTLQLGPREQARNASCPAGGRPADRRFRPPTNLRSVSPWAYRISYDPARYPRYLPEAYCLCRGCLTGLFGEEDVRFRSAPVYMPTVVLRRTPACAGGRSVYTEAYVTIPVGCTCVPEPEKDADSINSSIDKQGAKLLLGPNDAPAGP
Research Backgrounds
Induces expression of IL6, CXCL8/IL8, and CSF2/GM-CSF from endothelial cells.
Secreted.
Expressed preferentially in adipose, skeletal muscle and CNS.
Belongs to the IL-17 family.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction. (View pathway)
· Environmental Information Processing > Signal transduction > Jak-STAT signaling pathway. (View pathway)
· Organismal Systems > Immune system > IL-17 signaling pathway. (View pathway)
· Organismal Systems > Immune system > Th17 cell differentiation. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.