Product: IRGM Antibody
Catalog: DF13812
Description: Rabbit polyclonal antibody to IRGM
Application: IF/ICC
Reactivity: Human, Mouse
Mol.Wt.: 20,35kD; 20kD(Calculated).
Uniprot: A1A4Y4

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse
Clonality:
Polyclonal
Specificity:
IRGM Antibody detects endogenous levels of total IRGM.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

IFI1; Iigp3; Iipg3; Immunity related GTPase family M protein 1; Immunity related GTPase family, M; Immunity-related GTPase family M protein 1; Immunity-related GTPase family M protein; Interferon inducible protein 1; Interferon-inducible protein 1; Irgm; IRGM_HUMAN; IRGM1; LPS-stimulated RAW 264.7 macrophage protein 47 homolog; LRG 47; LRG-47; LRG-47-like protein; LRG47; MGC149263; MGC149264;

Immunogens

Immunogen:

A synthesized peptide derived from Human IRGM.

Uniprot:
Gene(ID):
Expression:
A1A4Y4 IRGM_HUMAN:

Widely expressed (at protein level). Expressed in several tissues including colon, small bowel and peripheral blood leukocytes.

Sequence:
MEAMNVEKASADGNLPEVISNIKETLKIVSRTPVNITMAGDSGNGMSTFISALRNTGHEGKASPPTELVKATQRCASYFSSHFSNVVLWDLPGTGSATTTLENYLMEMQFNRYDFIMVASAQFSMNHVMLAKTAEDMGKKFYIVWTKLDMDLSTGALPEVQLLQIRENVLENLQKERVCEY

Research Backgrounds

Function:

Putative GTPase which is required for clearance of acute protozoan and bacterial infections. Functions in innate immune response probably through regulation of autophagy. May regulate proinflammatory cytokine production and prevent endotoxemia upon infection. May also play a role in macrophages adhesion and motility (By similarity).

Subcellular Location:

Golgi apparatus membrane. Cell membrane. Cytoplasmic vesicle>Phagosome membrane. Cytoplasmic vesicle>Autophagosome membrane. Cell projection>Phagocytic cup.
Note: Behaves like an integral membrane protein. Recruited to the plasma membrane around forming phagocytic cups, it remains associated with maturing autophagosomes. Preferentially associated with cis- and medial-Golgi.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Widely expressed (at protein level). Expressed in several tissues including colon, small bowel and peripheral blood leukocytes.

Family&Domains:

The G5 motif of the IRG-type G domain is missing because the IRGM protein is truncated in anthropoids.

Belongs to the TRAFAC class dynamin-like GTPase superfamily. IRG family.

Research Fields

· Human Diseases > Infectious diseases: Parasitic > Toxoplasmosis.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.