NANP Antibody - #DF13805
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
1600031M04Rik; C20orf147; dJ694B14.3; Haloacid dehalogenase like hydrolase domain containing 4; Haloacid dehalogenase like hydrolase domain containing protein 4; Haloacid dehalogenase-like hydrolase domain-containing protein 4; HDHD4; MGC103377; MGC105812; MGC26833; N acetylneuraminic acid phosphatase; N acylneuraminate 9 phosphatase; N-acylneuraminate-9-phosphatase; Nanp; NANP_HUMAN; Neu5Ac 9 Pase; Neu5Ac-9-Pase; OTTMUSP00000016814; RGD1306009; RP23-193L22.6;
Immunogens
A synthesized peptide derived from Human NANP.
- Q8TBE9 NANP_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGLSRVRAVFFDLDNTLIDTAGASRRGMLEVIKLLQSKYHYKEEAEIICDKVQVKLSKECFHPYNTCITDLRTSHWEEAIQETKGGAANRKLAEECYFLWKSTRLQHMTLAEDVKAMLTELRKEVRLLLLTNGDRQTQREKIEACACQSYFDAVVVGGEQREEKPAPSIFYYCCNLLGVQPGDCVMVGDTLETDIQGGLNAGLKATVWINKNGIVPLKSSPVPHYMVSSVLELPALLQSIDCKVSMST
Research Backgrounds
Belongs to the HAD-like hydrolase superfamily. NANP family.
Research Fields
· Metabolism > Carbohydrate metabolism > Amino sugar and nucleotide sugar metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.