IL23 Antibody - #DF13760

(2)   (5)  
Product: IL23 Antibody
Catalog: DF13760
Description: Rabbit polyclonal antibody to IL23
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 23kD; 21kD(Calculated).
Uniprot: Q9NPF7

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MS Report
HPLC Report
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IF/ICC 1:100-1:500, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
IL23 Antibody detects endogenous levels of total IL23.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.

Immunogens

Immunogen:

A synthesized peptide derived from Human IL23.

Uniprot:

Q9NPF7(IL23A_HUMAN) >>Visit HPA database.

Gene(ID):
IL23A(51561)
Expression:
Q9NPF7 IL23A_HUMAN:

Secreted by activated dendritic and phagocytic cells and keratinocytes. Also expressed by dermal Langerhans cells (at protein level).

Sequence:
MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP

Research Backgrounds

Function:

Associates with IL12B to form the IL-23 interleukin, a heterodimeric cytokine which functions in innate and adaptive immunity. IL-23 may constitute with IL-17 an acute response to infection in peripheral tissues. IL-23 binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activates the Jak-Stat signaling cascade, stimulates memory rather than naive T-cells and promotes production of proinflammatory cytokines. IL-23 induces autoimmune inflammation and thus may be responsible for autoimmune inflammatory diseases and may be important for tumorigenesis.

Subcellular Location:

Secreted.
Note: Secreted upon association with IL12B.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Secreted by activated dendritic and phagocytic cells and keratinocytes. Also expressed by dermal Langerhans cells (at protein level).

Subunit Structure:

Heterodimer with IL12B; disulfide-linked. The heterodimer is known as interleukin IL-23.

Family&Domains:

Belongs to the IL-6 superfamily.

Research Fields

· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction.   (View pathway)

· Environmental Information Processing > Signal transduction > Jak-STAT signaling pathway.   (View pathway)

· Human Diseases > Infectious diseases: Bacterial > Pertussis.

· Human Diseases > Infectious diseases: Bacterial > Tuberculosis.

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Human Diseases > Immune diseases > Inflammatory bowel disease (IBD).

· Human Diseases > Immune diseases > Rheumatoid arthritis.

· Organismal Systems > Immune system > Th17 cell differentiation.   (View pathway)

References

1). Traditional Chinese Medicine Shi-Bi-Man ameliorates psoriasis via inhibiting IL-23/Th17 axis and CXCL16-mediated endothelial activation. Chinese medicine, 2024 (PubMed: 38429819) [IF=4.9]

Application: IF/ICC    Species: Human    Sample: T cells

Fig. 5 SBM inhibits the IL-23/Th17 axis. A Volcano plot for T cells, genes in red represented genes upregulated by IMQ, and genes in blue were downregulated by SBM. B Dotplot for the expression of genes related to IL-23/Th17 axis in T cells and keratinocytes. C Immunofluorescence images staining for CD3E (green), E-cadherin (green), IL-23 (red), IL-17A (red), and DAPI (blue) of skin tissue, scale bar = 20 μm
2). Histological Study on the Possible Ameliorating Consequence of Blocking STAT-3 Pathway on Psoriasis Model in Adult Male Albino rat. Egyptian Journal of Medical Research, 2023

Application: WB    Species: Rat    Sample:

Fig. 4: Photomicrographs of IL-23 immunostained sections in the skin [anti IL-23 immunohistochemical stain, x400]: 4a (the control group, group I): Scarce positive cytoplasmic immunoreaction (arrows) is noted in keratinocytes and dermal mononuclear cells. 4b (IMQ group, group II): Widely distributed positive cytoplasmic immunoreaction (arrows) in the keratinocytes and the dermal inflammatory cell infiltrate is seen. 4c (IMQ/STA-21 group, group III): Positive immunoreaction (arrows) can be seen confined to few keratinocytes and few mononuclear inflammatory cells in dermis. 4d: Showing the mean area percent of IL-23 positive immunoreaction.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.