Stathmin 1 Antibody | Affinity Biosciences

Product:	Stathmin 1 Antibody
Catalog:	AF6966
Description:	Rabbit polyclonal antibody to Stathmin 1
Application:	ELISA(peptide)
Reactivity:	Human, Mouse, Rat
Mol.Wt.:	17kD(Calculated).
Uniprot:	P16949
RRID:	AB_2847756

View similar products>>

Related products

Secondary Antibodies
Blocking Peptides

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific.

Size	Price	Inventory
100ul	$280	In stock
200ul	$350	In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Related Downloads

MSDS

Data Sheet

COA

Protocols

WB Handbook

IHC Protocol

IF/ICC Protocol

Product Info

Source:

Rabbit

Application:

ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:

Human,Mouse,Rat

Clonality:

Polyclonal

Specificity:

Stathmin 1 Antibody detects endogenous levels of total Stathmin 1.

RRID:

AB_2847756
Cite Format: Affinity Biosciences Cat# AF6966, RRID:AB_2847756.

Conjugate:

Unconjugated.

Purification:

The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).

Storage:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.

Alias:

Fold/Unfold

C1orf215; Lag; LAP 18; LAP18; Leukemia associated phosphoprotein p18; Leukemia-associated phosphoprotein p18; Metablastin; Oncoprotein 18; OP 18; Op18; p18; p19; Phosphoprotein 19; Phosphoprotein p19; pp17; pp19; PR22; Pr22 protein; Prosolin; Protein Pr22; SMN; Stathmin; Stathmin1; STMN 1; Stmn1; STMN1_HUMAN;

Immunogens

Immunogen:

A synthesized peptide derived from human Stathmin 1.

Uniprot:

P16949(STMN1_HUMAN) >>Visit HPA database.

Gene(ID):

STMN1(3925)

Expression:

P16949 STMN1_HUMAN:

Ubiquitous. Expression is strongest in fetal and adult brain, spinal cord, and cerebellum, followed by thymus, bone marrow, testis, and fetal liver. Expression is intermediate in colon, ovary, placenta, uterus, and trachea, and is readily detected at substantially lower levels in all other tissues examined. Lowest expression is found in adult liver. Present in much greater abundance in cells from patients with acute leukemia of different subtypes than in normal peripheral blood lymphocytes, non-leukemic proliferating lymphoid cells, bone marrow cells, or cells from patients with chronic lymphoid or myeloid leukemia.

Sequence:

P16949 STMN1_HUMAN:
Protein BLAST With
NCBI/
ExPASy/
Uniprot

MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD

PTMs - P16949 As Substrate

P16949

Site	PTM Type	Enzyme	Source
A2	Acetylation		Uniprot
S3	Phosphorylation		Uniprot
S4	Phosphorylation		Uniprot
K9	Acetylation		Uniprot
K9	Ubiquitination		Uniprot
R14	Methylation		Uniprot
S16	Phosphorylation	Q13153 (PAK1) , Q16566 (CAMK4) , Q13554 (CAMK2B) , P17612 (PRKACA) , Q9UQM7 (CAMK2A)	Uniprot
S25	Phosphorylation	P53778 (MAPK12) , P45983 (MAPK8) , P24941 (CDK2) , P27361 (MAPK3) , Q15759 (MAPK11) , P05771 (PRKCB) , P45984 (MAPK9) , O15264 (MAPK13) , P06493 (CDK1) , Q16539 (MAPK14) , P53779 (MAPK10) , P28482 (MAPK1)	Uniprot
R27	Methylation		Uniprot
S28	Phosphorylation		Uniprot
K29	Acetylation		Uniprot
K29	Methylation		Uniprot
K29	Ubiquitination		Uniprot
S31	Phosphorylation		Uniprot
S38	Phosphorylation	Q00535 (CDK5) , O15264 (MAPK13) , P45983 (MAPK8) , Q8TAS1 (UHMK1) , Q13153 (PAK1) , P05771 (PRKCB) , P06493 (CDK1) , P28482 (MAPK1) , P53779 (MAPK10) , P24941 (CDK2) , P45984 (MAPK9) , P27361 (MAPK3)	Uniprot
K41	Ubiquitination		Uniprot
K43	Ubiquitination		Uniprot
S46	Phosphorylation		Uniprot
K52	Acetylation		Uniprot
K52	Ubiquitination		Uniprot
K53	Acetylation		Uniprot
K53	Ubiquitination		Uniprot
K62	Ubiquitination		Uniprot
S63	Phosphorylation	P17612 (PRKACA)	Uniprot
K70	Acetylation		Uniprot
K70	Ubiquitination		Uniprot
K75	Ubiquitination		Uniprot
K80	Acetylation		Uniprot
K80	Ubiquitination		Uniprot
K85	Ubiquitination		Uniprot
S94	Phosphorylation		Uniprot
K95	Acetylation		Uniprot
K95	Ubiquitination		Uniprot
K100	Acetylation		Uniprot
K100	Ubiquitination		Uniprot
T102	Phosphorylation		Uniprot
K104	Acetylation		Uniprot
K104	Ubiquitination		Uniprot
K109	Acetylation		Uniprot
K119	Acetylation		Uniprot
K119	Ubiquitination		Uniprot
K128	Acetylation		Uniprot
K128	Ubiquitination		Uniprot
R134	Methylation		Uniprot
K137	Acetylation		Uniprot
K137	Ubiquitination		Uniprot
K140	Ubiquitination		Uniprot
T146	Phosphorylation		Uniprot

Research Backgrounds

P16949_STMN1_HUMAN

Function:

Involved in the regulation of the microtubule (MT) filament system by destabilizing microtubules. Prevents assembly and promotes disassembly of microtubules. Phosphorylation at Ser-16 may be required for axon formation during neurogenesis. Involved in the control of the learned and innate fear (By similarity).

PTMs:

Many different phosphorylated forms are observed depending on specific combinations among the sites which can be phosphorylated. MAPK is responsible for the phosphorylation of stathmin in response to NGF. Phosphorylation at Ser-16 seems to be required for neuron polarization (By similarity). Phosphorylation at Ser-63 reduces tubulin binding 10-fold and suppresses the MT polymerization inhibition activity.

Subcellular Location:

Cytoplasm>Cytoskeleton.

Tissue Specificity:

Subunit Structure:

Binds to two alpha/beta-tubulin heterodimers. Interacts with KIST.

Family&Domains:

Belongs to the stathmin family.

Research Fields

· Environmental Information Processing > Signal transduction > MAPK signaling pathway. (View pathway)

· Human Diseases > Cancers: Overview > MicroRNAs in cancer.

Restrictive clause

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.

Stathmin 1 Antibody - #AF6966