Product: PEA15 Antibody
Catalog: AF6963
Description: Rabbit polyclonal antibody to PEA15
Application: ELISA(peptide)
Reactivity: Human, Mouse
Mol.Wt.: 15kD(Calculated).
Uniprot: Q15121
RRID: AB_2847753

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse
Clonality:
Polyclonal
Specificity:
PEA15 Antibody detects endogenous levels of total PEA15.
RRID:
AB_2847753
Cite Format: Affinity Biosciences Cat# AF6963, RRID:AB_2847753.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

15 kDa phosphoprotein enriched in astrocytes; Astrocytic phosphoprotein PEA 15; Astrocytic phosphoprotein PEA-15; Astrocytic phosphoprotein PEA15; HMAT 1; HMAT1; Homolog of mouse MAT 1 oncogene; Homolog of mouse MAT1 oncogene; HUMMAT 1H; HUMMAT1H; MAT 1; MAT 1H; MAT1; MAT1H; PEA 15; Pea15; PEA15 protein; PEA15_HUMAN; PED; Phosphoprotein enriched in astrocytes 15; Phosphoprotein enriched in astrocytes 15kD; Phosphoprotein enriched in diabetes;

Immunogens

Immunogen:

A synthesized peptide derived from human PEA15.

Uniprot:
Gene(ID):
Expression:
Q15121 PEA15_HUMAN:

Ubiquitously expressed. Most abundant in tissues such as heart, brain, muscle and adipose tissue which utilize glucose as an energy source. Lower expression in glucose-producing tissues. Higher levels of expression are found in tissues from individuals with type 2 diabetes than in controls.

Sequence:
MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA

PTMs - Q15121 As Substrate

Site PTM Type Enzyme
Y4 Phosphorylation
T6 Phosphorylation
K24 Ubiquitination
S25 Phosphorylation
C27 S-Nitrosylation
K28 Ubiquitination
S43 Phosphorylation
K54 Ubiquitination
S61 Phosphorylation
S90 Phosphorylation
T97 Phosphorylation
K98 Ubiquitination
T100 Phosphorylation
S104 Phosphorylation P17252 (PRKCA)
Y108 Phosphorylation
K109 Methylation
S116 Phosphorylation P31749 (AKT1) , Q9UQM7 (CAMK2A) , P54646 (PRKAA2)

Research Backgrounds

Function:

Blocks Ras-mediated inhibition of integrin activation and modulates the ERK MAP kinase cascade. Inhibits RPS6KA3 activities by retaining it in the cytoplasm (By similarity). Inhibits both TNFRSF6- and TNFRSF1A-mediated CASP8 activity and apoptosis. Regulates glucose transport by controlling both the content of SLC2A1 glucose transporters on the plasma membrane and the insulin-dependent trafficking of SLC2A4 from the cell interior to the surface.

PTMs:

Phosphorylated by protein kinase C and calcium-calmodulin-dependent protein kinase. These phosphorylation events are modulated by neurotransmitters or hormones.

Subcellular Location:

Cytoplasm.
Note: Associated with microtubules.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Ubiquitously expressed. Most abundant in tissues such as heart, brain, muscle and adipose tissue which utilize glucose as an energy source. Lower expression in glucose-producing tissues. Higher levels of expression are found in tissues from individuals with type 2 diabetes than in controls.

Subunit Structure:

Binds RPS6KA3, MAPK3 and MAPK1. Transient interaction with PLD1 and PLD2 (By similarity). Interacts with CASP8 and FADD.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.