AOS1 Antibody - #AF0266
Product: | AOS1 Antibody |
Catalog: | AF0266 |
Description: | Rabbit polyclonal antibody to AOS1 |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 38kDa; 38kD(Calculated). |
Uniprot: | Q9UBE0 |
RRID: | AB_2833440 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF0266, RRID:AB_2833440.
Fold/Unfold
Activator of SUMO1; AOS1; HSPC140; Sae1; SAE1_HUMAN; Sentrin/SUMO activating protein AOS1; SUA1; SUMO 1 activating enzyme E1 N subunit; SUMO 1 activating enzyme subunit 1; SUMO-activating enzyme subunit 1; Ubiquitin like protein SUMO1 activating enzyme; Ubiquitin-like 1-activating enzyme E1A; UBL E1A; UBLE1A;
Immunogens
Expression level increases during S phase and drops in G2 phase (at protein level).
- Q9UBE0 SAE1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPDTKRAKLDSSETTMVKKKVVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKGRDPSSDTYEEDSELLLQIRNDVLDSLGISPDLLPEDFVRYCFSEMAPVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGNGIVECLGPK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9UBE0 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
M1 | Acetylation | Uniprot | |
V2 | Acetylation | Uniprot | |
S12 | Phosphorylation | Uniprot | |
R24 | Methylation | Uniprot | |
K32 | Ubiquitination | Uniprot | |
S37 | Phosphorylation | Uniprot | |
K45 | Ubiquitination | Uniprot | |
K53 | Ubiquitination | Uniprot | |
K61 | Ubiquitination | Uniprot | |
K109 | Sumoylation | Uniprot | |
K109 | Ubiquitination | Uniprot | |
K141 | Ubiquitination | Uniprot | |
K148 | Ubiquitination | Uniprot | |
S150 | Phosphorylation | Uniprot | |
K178 | Ubiquitination | Uniprot | |
K183 | Ubiquitination | Uniprot | |
S185 | Phosphorylation | Uniprot | |
K195 | Acetylation | Uniprot | |
K195 | Sumoylation | Uniprot | |
K195 | Ubiquitination | Uniprot | |
K198 | Acetylation | Uniprot | |
K198 | Ubiquitination | Uniprot | |
S201 | Phosphorylation | Uniprot | |
K208 | Ubiquitination | Uniprot | |
K210 | Ubiquitination | Uniprot | |
K217 | Ubiquitination | Uniprot | |
K228 | Acetylation | Uniprot | |
K228 | Ubiquitination | Uniprot | |
Y262 | Phosphorylation | Uniprot | |
S266 | Phosphorylation | Uniprot | |
K335 | Ubiquitination | Uniprot |
Research Backgrounds
The heterodimer acts as an E1 ligase for SUMO1, SUMO2, SUMO3, and probably SUMO4. It mediates ATP-dependent activation of SUMO proteins followed by formation of a thioester bond between a SUMO protein and a conserved active site cysteine residue on UBA2/SAE2.
Nucleus.
Expression level increases during S phase and drops in G2 phase (at protein level).
Heterodimer of SAE1 and UBA2/SAE2. The heterodimer corresponds to the two domains that are encoded on a single polypeptide chain in ubiquitin-activating enzyme E1. Interacts with UBE2I.
Belongs to the ubiquitin-activating E1 family.
Research Fields
· Genetic Information Processing > Folding, sorting and degradation > Ubiquitin mediated proteolysis. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.