Product: Phospho-Stathmin 1 (Ser63) Antibody
Catalog: AF3966
Description: Rabbit polyclonal antibody to Phospho-Stathmin 1 (Ser63)
Application: ELISA(peptide)
Reactivity: Human, Mouse, Rat
Mol.Wt.: 17kD(Calculated).
Uniprot: P16949
RRID: AB_2847689

View similar products>>

   Size Price Inventory
 100ul $350 In stock
 200ul $450 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
Phospho-Stathmin 1 (Ser63) Antibody detects endogenous levels of Stathmin 1 only when phosphorylated at Ser63.
RRID:
AB_2847689
Cite Format: Affinity Biosciences Cat# AF3966, RRID:AB_2847689.
Conjugate:
Unconjugated.
Purification:
The antibody is from purified rabbit serum by affinity purification via sequential chromatography on phospho-peptide and non-phospho-peptide affinity columns.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

C1orf215; Lag; LAP 18; LAP18; Leukemia associated phosphoprotein p18; Leukemia-associated phosphoprotein p18; Metablastin; Oncoprotein 18; OP 18; Op18; p18; p19; Phosphoprotein 19; Phosphoprotein p19; pp17; pp19; PR22; Pr22 protein; Prosolin; Protein Pr22; SMN; Stathmin; Stathmin1; STMN 1; Stmn1; STMN1_HUMAN;

Immunogens

Immunogen:

A synthesized peptide derived from human Stathmin 1 around the phosphorylation site of Ser63.

Uniprot:
Gene(ID):
Expression:
P16949 STMN1_HUMAN:

Ubiquitous. Expression is strongest in fetal and adult brain, spinal cord, and cerebellum, followed by thymus, bone marrow, testis, and fetal liver. Expression is intermediate in colon, ovary, placenta, uterus, and trachea, and is readily detected at substantially lower levels in all other tissues examined. Lowest expression is found in adult liver. Present in much greater abundance in cells from patients with acute leukemia of different subtypes than in normal peripheral blood lymphocytes, non-leukemic proliferating lymphoid cells, bone marrow cells, or cells from patients with chronic lymphoid or myeloid leukemia.

Sequence:
MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD

PTMs - P16949 As Substrate

Site PTM Type Enzyme
A2 Acetylation
S3 Phosphorylation
S4 Phosphorylation
K9 Acetylation
K9 Ubiquitination
R14 Methylation
S16 Phosphorylation Q13153 (PAK1) , Q16566 (CAMK4) , Q13554 (CAMK2B) , P17612 (PRKACA) , Q9UQM7 (CAMK2A)
S25 Phosphorylation P53778 (MAPK12) , P45983 (MAPK8) , P24941 (CDK2) , P27361 (MAPK3) , Q15759 (MAPK11) , P05771 (PRKCB) , P45984 (MAPK9) , O15264 (MAPK13) , P06493 (CDK1) , Q16539 (MAPK14) , P53779 (MAPK10) , P28482 (MAPK1)
R27 Methylation
S28 Phosphorylation
K29 Acetylation
K29 Methylation
K29 Ubiquitination
S31 Phosphorylation
S38 Phosphorylation Q00535 (CDK5) , O15264 (MAPK13) , P45983 (MAPK8) , Q8TAS1 (UHMK1) , Q13153 (PAK1) , P05771 (PRKCB) , P06493 (CDK1) , P28482 (MAPK1) , P53779 (MAPK10) , P24941 (CDK2) , P45984 (MAPK9) , P27361 (MAPK3)
K41 Ubiquitination
K43 Ubiquitination
S46 Phosphorylation
K52 Acetylation
K52 Ubiquitination
K53 Acetylation
K53 Ubiquitination
K62 Ubiquitination
S63 Phosphorylation P17612 (PRKACA)
K70 Acetylation
K70 Ubiquitination
K75 Ubiquitination
K80 Acetylation
K80 Ubiquitination
K85 Ubiquitination
S94 Phosphorylation
K95 Acetylation
K95 Ubiquitination
K100 Acetylation
K100 Ubiquitination
T102 Phosphorylation
K104 Acetylation
K104 Ubiquitination
K109 Acetylation
K119 Acetylation
K119 Ubiquitination
K128 Acetylation
K128 Ubiquitination
R134 Methylation
K137 Acetylation
K137 Ubiquitination
K140 Ubiquitination
T146 Phosphorylation

Research Backgrounds

Function:

Involved in the regulation of the microtubule (MT) filament system by destabilizing microtubules. Prevents assembly and promotes disassembly of microtubules. Phosphorylation at Ser-16 may be required for axon formation during neurogenesis. Involved in the control of the learned and innate fear (By similarity).

PTMs:

Many different phosphorylated forms are observed depending on specific combinations among the sites which can be phosphorylated. MAPK is responsible for the phosphorylation of stathmin in response to NGF. Phosphorylation at Ser-16 seems to be required for neuron polarization (By similarity). Phosphorylation at Ser-63 reduces tubulin binding 10-fold and suppresses the MT polymerization inhibition activity.

Subcellular Location:

Cytoplasm>Cytoskeleton.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Ubiquitous. Expression is strongest in fetal and adult brain, spinal cord, and cerebellum, followed by thymus, bone marrow, testis, and fetal liver. Expression is intermediate in colon, ovary, placenta, uterus, and trachea, and is readily detected at substantially lower levels in all other tissues examined. Lowest expression is found in adult liver. Present in much greater abundance in cells from patients with acute leukemia of different subtypes than in normal peripheral blood lymphocytes, non-leukemic proliferating lymphoid cells, bone marrow cells, or cells from patients with chronic lymphoid or myeloid leukemia.

Subunit Structure:

Binds to two alpha/beta-tubulin heterodimers. Interacts with KIST.

Family&Domains:

Belongs to the stathmin family.

Research Fields

· Environmental Information Processing > Signal transduction > MAPK signaling pathway.   (View pathway)

· Human Diseases > Cancers: Overview > MicroRNAs in cancer.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.