RAB7L1 Antibody - #AF6777
| Product: | RAB7L1 Antibody |
| Catalog: | AF6777 |
| Description: | Rabbit polyclonal antibody to RAB7L1 |
| Application: | WB |
| Reactivity: | Human, Mouse, Rat |
| Mol.Wt.: | 23kD(Calculated). |
| Uniprot: | O14966 |
| RRID: | AB_2847500 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF6777, RRID:AB_2847500.
Fold/Unfold
DKFZp686P1051; Rab 7 like protein 1; RAB 7L; Rab-7-like protein 1; RAB29; Rab7 like protein 1; RAB7 member RAS oncogene family like 1; RAB7L; RAB7L_HUMAN; Ras related protein Rab 7L1; Ras related protein Rab7L1; Ras-related protein Rab-29; Ras-related protein Rab-7L1;
Immunogens
- O14966 RAB7L_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGSRDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQWSDYEIVRLQLWDIAGQERFTSMTRLYYRDASACVIMFDVTNATTFSNSQRWKQDLDSKLTLPNGEPVPCLLLANKCDLSPWAVSRDQIDRFSKENGFTGWTETSVKENKNINEAMRVLIEKMMRNSTEDIMSLSTQGDYINLQTKSSSWSCC
PTMs - O14966 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K20 | Ubiquitination | Uniprot | |
| S31 | Phosphorylation | Uniprot | |
| K34 | Ubiquitination | Uniprot | |
| S38 | Phosphorylation | Uniprot | |
| T39 | Phosphorylation | Uniprot | |
| S52 | Phosphorylation | Uniprot | |
| Y54 | Phosphorylation | Uniprot | |
| T71 | Phosphorylation | Uniprot | |
| S72 | Phosphorylation | Uniprot | |
| K103 | Ubiquitination | Uniprot | |
| S130 | Phosphorylation | Uniprot | |
| S135 | Phosphorylation | Uniprot | |
| K144 | Ubiquitination | Uniprot | |
| T149 | Phosphorylation | Uniprot | |
| T154 | Phosphorylation | Uniprot | |
| S155 | Phosphorylation | Uniprot | |
| K157 | Ubiquitination | Uniprot | |
| K160 | Ubiquitination | Uniprot | |
| K172 | Ubiquitination | Uniprot | |
| S185 | Phosphorylation | Uniprot | |
| T186 | Phosphorylation | Uniprot | |
| Y190 | Phosphorylation | Uniprot |
Research Backgrounds
The small GTPases Rab are key regulators in vesicle trafficking. Essential for maintaining the integrity of the endosome-trans-Golgi network structure (By similarity). Together with LRRK2, plays a role in the retrograde trafficking pathway for recycling proteins, such as mannose 6 phosphate receptor (M6PR), between lysosomes and the Golgi apparatus in a retromer-dependent manner. Recruits LRRK2 to the Golgi complex and stimulates LRRK2 kinase activity. Regulates neuronal process morphology in the intact central nervous system (CNS) (By similarity). May play a role in the formation of typhoid toxin transport intermediates during Salmonella enterica serovar Typhi (S.Typhi) epithelial cell infection.
In case of Salmonella enterica serovar Typhimurium (S.Typhimurium) infection, is proteolytically cleaved between Gly-41 and Val-42 by the GtgE viral protease encoded on the Gifsy-2 lysogen bacteriophage, which therefore prevents the recruitment of RAB29 to S.Typhimurium-containing vacuoles. In contrast, no proteolytically cleavage is detected in S.Typhi-infected cells.
Cell membrane>Lipid-anchor>Cytoplasmic side. Cytoplasm. Cytoplasm>Perinuclear region. Golgi apparatus. Golgi apparatus>trans-Golgi network. Vacuole. Cytoplasm>Cytoskeleton.
Note: Colocalizes with LRRK2 along tubular structures emerging from Golgi apparatus (PubMed:29212815). Colocalizes with GM130 at the Golgi apparatus (PubMed:22042847). Colocalizes with dynamic tubules emerging from and retracting to the Golgi apparatus (PubMed:22042847). Colocalizes with TGN46 at the trans-Golgi network (TGN) (PubMed:24788816). In Salmonella enterica serovar Typhi (S.Typhi) infected epithelial cells, is recruited and colocalized with both S.Typhi-containing vacuoles and dynamic tubules as well as those emerging from the vacuole toward the cell periphery (PubMed:22042847).
Ubiquitous.
Interacts with LRRK2.
Belongs to the small GTPase superfamily. Rab family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.