Product: Cyclin B1 Antibody
Catalog: AF6168
Description: Rabbit polyclonal antibody to Cyclin B1
Application: WB IHC IF/ICC
Cited expt.: WB, IHC
Reactivity: Human, Mouse, Rat
Prediction: Bovine, Horse, Sheep, Rabbit, Dog
Mol.Wt.: 60kDa; 48kD(Calculated).
Uniprot: P14635
RRID: AB_2835034

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Bovine(91%), Horse(91%), Sheep(91%), Rabbit(91%), Dog(91%)
Clonality:
Polyclonal
Specificity:
Cyclin B1 Antibody detects endogenous levels of total Cyclin B1.
RRID:
AB_2835034
Cite Format: Affinity Biosciences Cat# AF6168, RRID:AB_2835034.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

CCNB 1; CCNB; ccnb1; CCNB1_HUMAN; Cyclin B1; G2 mitotic specific cyclin B1; G2/mitotic-specific cyclin-B1;

Immunogens

Immunogen:

A synthesized peptide derived from human Cyclin B1, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Description:
a member of the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases.
Sequence:
MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQLEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRPLPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAVAKV

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Horse
91
Bovine
91
Sheep
91
Dog
91
Rabbit
91
Xenopus
67
Pig
0
Zebrafish
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Essential for the control of the cell cycle at the G2/M (mitosis) transition.

PTMs:

Ubiquitinated by the SCF(NIPA) complex during interphase, leading to its destruction. Not ubiquitinated during G2/M phases.

Phosphorylated by PLK1 at Ser-133 on centrosomes during prophase: phosphorylation by PLK1 does not cause nuclear import. Phosphorylation at Ser-147 was also reported to be mediated by PLK1 but Ser-133 seems to be the primary phosphorylation site.

Subcellular Location:

Cytoplasm. Nucleus. Cytoplasm>Cytoskeleton>Microtubule organizing center>Centrosome.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the cyclin family. Cyclin AB subfamily.

Research Fields

· Cellular Processes > Cell growth and death > Cell cycle.   (View pathway)

· Cellular Processes > Cell growth and death > Oocyte meiosis.   (View pathway)

· Cellular Processes > Cell growth and death > p53 signaling pathway.   (View pathway)

· Cellular Processes > Cell growth and death > Cellular senescence.   (View pathway)

· Environmental Information Processing > Signal transduction > FoxO signaling pathway.   (View pathway)

· Organismal Systems > Endocrine system > Progesterone-mediated oocyte maturation.

References

1). P2Y14R activation facilitates liver regeneration via CREB/DNMT3b/Dact-2/ β-Catenin signals in acute liver failure. Acta pharmaceutica Sinica. B, 2025 (PubMed: 40177539) [IF=14.7]

2). Secalonic acid D induces cell apoptosis in both sensitive and ABCG2-overexpressing multidrug resistant cancer cells through upregulating c-Jun expression. Acta Pharmaceutica Sinica B, 2019 (PubMed: 31193763) [IF=14.7]

Application: WB    Species: human    Sample: S1 and S1-MI-80 cells

Figure 2 | Effect of SAD on cell cycle and apoptosis. (A) The cell cycle analysis was determined by PI staining and flow cytometry cell quest software. S1 and S1-MI-80 cells were treated with 4 μmol/L SAD for 12, 24, 48, and 72 h, respectively. The content of G2/M phase was increased in a time-dependent pattern. (B) Histograms of cell cycle distribution in non-treated and treated S1 and S1-MI-80 cells. (C) S1 and S1-MI-80 cells were treated with SAD (4 μmol/L) for four different time points. Western blot analysis was used to detect the levels of CDC2, p-CDC2 and cyclin B1 protein after SAD treatment.

3). A hybrid nanopharmaceutical for specific-amplifying oxidative stress to initiate a cascade of catalytic therapy for pancreatic cancer. Journal of nanobiotechnology, 2023 (PubMed: 37221521) [IF=10.2]

4). Interfering with hyaluronic acid metabolism suppresses glioma cell proliferation by regulating autophagy. Cell Death & Disease, 2021 (PubMed: 33986244) [IF=8.1]

Application: WB    Species: human    Sample: U251 glioma cells

Fig. 7| 4-MU inhibits glioma growth in vivo and, when combined with autophagy inhibitors, exerts synergistic effects on glioma cell viability, autophagy levels, and the cell cycle. Relative levels of the CCNB1 and CCND1 proteins in U251 glioma cells cultured with 4-MU, followed by treatment with CQ (30 μmol/L) for 48 h.

5). Epigallocatechin gallate suppresses mitotic clonal expansion and adipogenic differentiation of preadipocytes through impeding JAK2/STAT3-mediated transcriptional cascades. Phytomedicine : international journal of phytotherapy and phytopharmacology, 2024 (PubMed: 38552377) [IF=6.7]

6). Ganoderma lucidum polysaccharide inhibits HSC activation and liver fibrosis via targeting inflammation, apoptosis, cell cycle, and ECM-receptor interaction mediated by TGF-β/Smad signaling. Phytomedicine, 2023 (PubMed: 36603342) [IF=6.7]

7). Silica nanoparticles cause spermatogenesis dysfunction in mice via inducing cell cycle arrest and apoptosis. ECOTOXICOLOGY AND ENVIRONMENTAL SAFETY, 2022 (PubMed: 35051769) [IF=6.2]

8). Design, synthesis, and biological evaluation of 1-styrenyl isoquinoline derivatives for anti-hepatocellular carcinoma activity and effect on mitochondria. European journal of medicinal chemistry, 2023 (PubMed: 37182331) [IF=6.0]

9). Design and synthesis of isatin derivative payloaded peptide-drug conjugate as tubulin inhibitor against colorectal cancer. European journal of medicinal chemistry, 2025 (PubMed: 39818012) [IF=6.0]

10). Silibinin Induces G2/M Cell Cycle Arrest by Activating Drp1-Dependent Mitochondrial Fission in Cervical Cancer. Frontiers in Pharmacology, 2020 (PubMed: 32226384) [IF=5.6]

Application: WB    Species: human    Sample: cervical cancer cells

FIGURE 3 | SB induces G2/M cell cycle arrest in cervical cancer cells. (A) A marked dose-dependent increase of the percentage of cervical cancer cells in the G2/M phase arrest by flow cytometry. (B) The protein expression levels of CDK1, cyclin B1, and cdc25C at 24 h after SB treatment. Expression levels were normalized to the β-actin protein level. Values (mean ± SDs) were obtained from at least three independent experiments. *P < 0.05, **P < 0.01, and ***P < 0.001 by one-way ANOVA with Tukey’s test

Load more

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.