GAP43 Antibody - #AF6715
Product: | GAP43 Antibody |
Catalog: | AF6715 |
Description: | Rabbit polyclonal antibody to GAP43 |
Application: | IF/ICC |
Reactivity: | Human, Mouse, Rat |
Mol.Wt.: | 25kD(Calculated). |
Uniprot: | P17677 |
RRID: | AB_2847438 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF6715, RRID:AB_2847438.
Fold/Unfold
Axonal membrane protein GAP 43; Axonal membrane protein GAP-43; B 50; Calmodulin binding protein P 57; F1; GAP 43; GAP43; Growth Associated Protein 43; Growth-associated protein 43; Nerve Growth Related Peptide; Nerve growth related peptide GAP43; NEUM_HUMAN; Neural phosphoprotein B 50; Neural phosphoprotein B-50; Neuromodulin; Neuron growth associated protein 43; PP46; Protein F1; QtrA-11580; QtrA-13071;
Immunogens
A synthesized peptide derived from human GAP43.
- P17677 NEUM_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAETESATKASTDNSPSSKAEDAPAKEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETGESSQAEENIEAVDETKPKESARQDEGKEEEPEADQEHA
PTMs - P17677 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
T36 | Phosphorylation | Uniprot | |
K37 | Ubiquitination | Uniprot | |
S41 | Phosphorylation | Q02156 (PRKCE) | Uniprot |
T107 | Phosphorylation | Uniprot | |
S109 | Phosphorylation | Uniprot | |
S131 | Phosphorylation | Uniprot | |
S142 | Phosphorylation | Uniprot | |
T144 | Phosphorylation | Uniprot | |
S147 | Phosphorylation | Uniprot | |
T148 | Phosphorylation | Uniprot | |
S151 | Phosphorylation | Uniprot | |
S154 | Phosphorylation | Uniprot | |
T181 | Phosphorylation | Uniprot | |
K216 | Methylation | Uniprot |
Research Backgrounds
This protein is associated with nerve growth. It is a major component of the motile 'growth cones' that form the tips of elongating axons. Plays a role in axonal and dendritic filopodia induction.
Phosphorylated (By similarity). Phosphorylation of this protein by a protein kinase C is specifically correlated with certain forms of synaptic plasticity (By similarity).
Palmitoylation by ARF6 is essential for plasma membrane association and axonal and dendritic filopodia induction. Deacylated by LYPLA2.
Cell membrane>Peripheral membrane protein>Cytoplasmic side. Cell projection>Growth cone membrane>Peripheral membrane protein>Cytoplasmic side. Cell junction>Synapse. Cell projection>Filopodium membrane>Peripheral membrane protein. Perikaryon. Cell projection>Dendrite. Cell projection>Axon. Cytoplasm.
Note: Cytoplasmic surface of growth cone and synaptic plasma membranes.
Identified in a complex containing FGFR4, NCAM1, CDH2, PLCG1, FRS2, SRC, SHC1, GAP43 and CTTN (By similarity). Interacts (via IQ domain) with calmodulin (By similarity). Binds calmodulin with a greater affinity in the absence of Ca(2+) than in its presence (By similarity).
Belongs to the neuromodulin family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.