Serotonin transporter Antibody - #AF6684
| Product: | Serotonin transporter Antibody |
| Catalog: | AF6684 |
| Description: | Rabbit polyclonal antibody to Serotonin transporter |
| Application: | ELISA(peptide) |
| Reactivity: | Human, Mouse, Rat |
| Mol.Wt.: | 70kD(Calculated). |
| Uniprot: | P31645 |
| RRID: | AB_2847407 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF6684, RRID:AB_2847407.
Fold/Unfold
5 HTT; 5 HTTLPR; 5 hydroxytryptamine (serotonin) transporter; 5 hydroxytryptamine transporter; 5HT transporter; 5HTT; hSERT; HTT; Na+/Cl- dependent serotonin transporter; OCD1; SC6A4_HUMAN; Serotonin transporter 1; SERT; SERT1; Slc6a4; Sodium dependent serotonin transporter; Sodium-dependent serotonin transporter; Solute carrier family 6 (neurotransmitter transporter) member 4; solute carrier family 6 (neurotransmitter transporter, serotonin), member 4; Solute carrier family 6 member 4;
Immunogens
A synthesized peptide derived from human Serotonin transporter.
- P31645 SC6A4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
METTPLNSQKQLSACEDGEDCQENGVLQKVVPTPGDKVESGQISNGYSAVPSPGAGDDTRHSIPATTTTLVAELHQGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICYQNGGGAFLLPYTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIMAWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIILSVLLVRGATLPGAWRGVLFYLKPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQDALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPASTFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITCFFGSLVTLTFGGAYVVKLLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRICWVAISPLFLLFIICSFLMSPPQLRLFQYNYPYWSIILGYCIGTSSFICIPTYIAYRLIITPGTFKERIIKSITPETPTEIPCGDIRLNAV
PTMs - P31645 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S13 | Phosphorylation | Q9UQM7 (CAMK2A) | Uniprot |
| Y47 | Phosphorylation | Uniprot | |
| T59 | Phosphorylation | Uniprot | |
| S62 | Phosphorylation | Uniprot | |
| T81 | Phosphorylation | Uniprot | |
| Y142 | Phosphorylation | Uniprot | |
| S149 | Phosphorylation | P17252 (PRKCA) | Uniprot |
| N208 | N-Glycosylation | Uniprot | |
| N217 | N-Glycosylation | Uniprot | |
| T276 | Phosphorylation | Q13976 (PRKG1) | Uniprot |
| S277 | Phosphorylation | P17252 (PRKCA) | Uniprot |
| T603 | Phosphorylation | P17252 (PRKCA) | Uniprot |
| S611 | Phosphorylation | Uniprot | |
| T613 | Phosphorylation | Uniprot | |
| T616 | Phosphorylation | P28482 (MAPK1) , P45984 (MAPK9) , P27361 (MAPK3) , Q16539 (MAPK14) | Uniprot |
Research Backgrounds
Serotonin transporter whose primary function in the central nervous system involves the regulation of serotonergic signaling via transport of serotonin molecules from the synaptic cleft back into the pre-synaptic terminal for re-utilization. Plays a key role in mediating regulation of the availability of serotonin to other receptors of serotonergic systems. Terminates the action of serotonin and recycles it in a sodium-dependent manner.
Glycosylated; modification with sialylated N-glycans is a requirement for transporters to associate with each other and to function as homooligomeric forms.
Phosphorylation at Thr-276 increases 5-HT uptake and is required for cGMP-mediated SERT regulation. Phosphorylation upon PKC stimulation modifies the SERT distribution and density in the membrane, and diminishes the uptake capacity.
Cell membrane>Multi-pass membrane protein. Endomembrane system>Multi-pass membrane protein. Endosome membrane>Multi-pass membrane protein. Cell junction>Synapse. Cell junction>Focal adhesion.
Note: Could be part of recycling endosomes (PubMed:18227069, PubMed:16870614). Density of transporter molecules on the plasma membrane is itself regulated by STX1A (By similarity). Density of transporter molecules on the plasma membrane is also regulated by serotonin (PubMed:17506858) (PubMed:18227069). Density of transporter molecules seems to be modulated by ITGAV:ITGB3 (By similarity).
Expressed in platelets (at protein level).
Monomer or homooligomer (By similarity). Interacts with TGFB1I1. Interacts (via sialylated form) with MYH9. Interacts with SEC23A, SEC24C and PATJ. Interacts with NOS1; the interaction may diminish the cell surface localization of SERT in the brain and, correspondingly, reduce serotonin reuptake. Interacts with filamentous actin and STX1A (By similarity). Interacts (via C-terminus) with VIM. Interacts (via C-terminus) with SCAMP2; the interaction is direct and retains transporter molecules intracellularly. Interacts with RAB4 (GTP-bound form); the interaction retains transporter molecules intracellularly. Interacts with ITGAV:ITGB3 (By similarity).
Belongs to the sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family. SLC6A4 subfamily.
Research Fields
· Organismal Systems > Nervous system > Serotonergic synapse.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.