IRF9 Antibody - #AF6625
Product: | IRF9 Antibody |
Catalog: | AF6625 |
Description: | Rabbit polyclonal antibody to IRF9 |
Application: | WB |
Reactivity: | Human, Mouse |
Mol.Wt.: | 44kD(Calculated). |
Uniprot: | Q00978 |
RRID: | AB_2847348 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF6625, RRID:AB_2847348.
Fold/Unfold
IFN alpha responsive transcription factor subunit; IFN-alpha-responsive transcription factor subunit; Interferon regulatory factor 9; interferon stimulated transcription factor 3; Interferon-stimulated gene factor 3 gamma; interferon-stimulated transcription factor 3, gamma 48kDa; IRF 9; IRF-9; Irf9; IRF9_HUMAN; ISGF 3 gamma; ISGF-3 gamma; ISGF3; ISGF3 p48 subunit; ISGF3G; OTTHUMP00000164692; OTTHUMP00000164693; p48; Transcriptional regulator ISGF3 subunit gamma;
Immunogens
A synthesized peptide derived from human IRF9.
- Q00978 IRF9_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MASGRARCTRKLRNWVVEQVESGQFPGVCWDDTAKTMFRIPWKHAGKQDFREDQDAAFFKAWAIFKGKYKEGDTGGPAVWKTRLRCALNKSSEFKEVPERGRMDVAEPYKVYQLLPPGIVSGQPGTQKVPSKRQHSSVSSERKEEEDAMQNCTLSPSVLQDSLNNEEEGASGGAVHSDIGSSSSSSSPEPQEVTDTTEAPFQGDQRSLEFLLPPEPDYSLLLTFIYNGRVVGEAQVQSLDCRLVAEPSGSESSMEQVLFPKPGPLEPTQRLLSQLERGILVASNPRGLFVQRLCPIPISWNAPQAPPGPGPHLLPSNECVELFRTAYFCRDLVRYFQGLGPPPKFQVTLNFWEESHGSSHTPQNLITVKMEQAFARYLLEQTPEQQAAILSLV
PTMs - Q00978 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K47 | Ubiquitination | Uniprot | |
K81 | Ubiquitination | Uniprot | |
S131 | Phosphorylation | Uniprot | |
S273 | Phosphorylation | Uniprot | |
T361 | Phosphorylation | Uniprot |
Research Backgrounds
Transcription factor that mediates signaling by type I IFNs (IFN-alpha and IFN-beta). Following type I IFN binding to cell surface receptors, Jak kinases (TYK2 and JAK1) are activated, leading to tyrosine phosphorylation of STAT1 and STAT2. IRF9/ISGF3G associates with the phosphorylated STAT1:STAT2 dimer to form a complex termed ISGF3 transcription factor, that enters the nucleus. ISGF3 binds to the IFN stimulated response element (ISRE) to activate the transcription of interferon stimulated genes, which drive the cell in an antiviral state.
Cytoplasm. Nucleus.
Note: Translocated into the nucleus upon activation by IFN-alpha/beta.
Interacts with STAT2 in the cytoplasm. Forms the interferon-stimulated gene factor 3 complex (ISGF3) with the heterodimer STAT1:STAT2; upon stimulation.
Belongs to the IRF family.
Research Fields
· Cellular Processes > Cell growth and death > Necroptosis. (View pathway)
· Environmental Information Processing > Signal transduction > Jak-STAT signaling pathway. (View pathway)
· Human Diseases > Infectious diseases: Viral > Hepatitis C.
· Human Diseases > Infectious diseases: Viral > Measles.
· Human Diseases > Infectious diseases: Viral > Influenza A.
· Human Diseases > Infectious diseases: Viral > Human papillomavirus infection.
· Human Diseases > Infectious diseases: Viral > Herpes simplex infection.
· Human Diseases > Cancers: Overview > Viral carcinogenesis.
· Organismal Systems > Development > Osteoclast differentiation. (View pathway)
· Organismal Systems > Immune system > NOD-like receptor signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.