ID2 Antibody - #AF6622
| Product: | ID2 Antibody |
| Catalog: | AF6622 |
| Description: | Rabbit polyclonal antibody to ID2 |
| Application: | ELISA(peptide) |
| Reactivity: | Human, Mouse, Rat |
| Mol.Wt.: | 15kD(Calculated). |
| Uniprot: | Q02363 |
| RRID: | AB_2847345 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF6622, RRID:AB_2847345.
Fold/Unfold
bHLHb26; Cell growth inhibiting gene 8; class B basic helix loop helix protein 26; Class B basic helix-loop-helix protein 26; DNA binding protein inhibitor ID 2; DNA binding protein inhibitor ID2; DNA-binding protein inhibitor ID-2; GIG 8; GIG8; Helix loop helix protein ID2; ID2; ID2_HUMAN; ID2A; ID2H; Inhibitor of differentiation 2; Inhibitor of DNA binding 2; Inhibitor of DNA binding 2, dominant negative helix loop helix protein; MGC26389;
Immunogens
A synthesized peptide derived from human ID2.
Highly expressed in early fetal tissues, including those of the central nervous system.
- Q02363 ID2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG
PTMs - Q02363 As Substrate
Research Backgrounds
Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. Implicated in regulating a variety of cellular processes, including cellular growth, senescence, differentiation, apoptosis, angiogenesis, and neoplastic transformation. Inhibits skeletal muscle and cardiac myocyte differentiation. Regulates the circadian clock by repressing the transcriptional activator activity of the CLOCK-ARNTL/BMAL1 heterodimer. Restricts the CLOCK and ARNTL/BMAL1 localization to the cytoplasm. Plays a role in both the input and output pathways of the circadian clock: in the input component, is involved in modulating the magnitude of photic entrainment and in the output component, contributes to the regulation of a variety of liver clock-controlled genes involved in lipid metabolism.
Cytoplasm. Nucleus.
Highly expressed in early fetal tissues, including those of the central nervous system.
Heterodimer with other HLH proteins. Interacts with GATA4, IFI204 and NKX2-5 (By similarity). Interacts with NR0B2. Interacts with CLOCK and ARNTL/BMAL1.
The bHLH domain is essential for its repressor activity towards the CLOCK-ARNTL/BMAL1 heterodimer.
Research Fields
· Cellular Processes > Cellular community - eukaryotes > Signaling pathways regulating pluripotency of stem cells. (View pathway)
· Environmental Information Processing > Signal transduction > TGF-beta signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > Hippo signaling pathway. (View pathway)
· Human Diseases > Cancers: Overview > Transcriptional misregulation in cancer.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.