CDC16/APC6 Antibody - #AF6608
Product: | CDC16/APC6 Antibody |
Catalog: | AF6608 |
Description: | Rabbit polyclonal antibody to CDC16/APC6 |
Application: | WB |
Reactivity: | Human, Mouse, Rat |
Mol.Wt.: | 72kD(Calculated). |
Uniprot: | Q13042 |
RRID: | AB_2847332 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF6608, RRID:AB_2847332.
Fold/Unfold
ANAPC6; Anaphase promoting complex subunit 6; Anaphase-promoting complex subunit 6; Apc 6; APC6; CDC 16; CDC16 (cell division cycle 16 S. cerevisiae homolog); Cdc16; CDC16 homolog; CDC16 protein; CDC16_HUMAN; CDC16Hs; Cell division cycle 16; Cell division cycle 16 homolog; Cell division cycle protein 16 homolog; CUT9; Cyclosome subunit 6;
Immunogens
A synthesized peptide derived from human CDC16/APC6.
- Q13042 CDC16_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MNLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHALRSRKLDKLYEACRYLAARCHYAAKEHQQALDVLDMEEPINKRLFEKYLKDESGFKDPSSDWEMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQEEKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVDGLQENLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIGADIKDKLKCYDFDVHTMKTLKNIISPPWDFREFEVEKQTAEETGLTPLETSRKTPDSRPSLEETFEIEMNESDMMLETSMSDHST
PTMs - Q13042 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
T50 | Phosphorylation | Uniprot | |
Y53 | Phosphorylation | Uniprot | |
K101 | Ubiquitination | Uniprot | |
K106 | Ubiquitination | Uniprot | |
K109 | Ubiquitination | Uniprot | |
S112 | Phosphorylation | P06493 (CDK1) , P53350 (PLK1) | Uniprot |
K115 | Ubiquitination | Uniprot | |
K129 | Ubiquitination | Uniprot | |
K138 | Ubiquitination | Uniprot | |
K154 | Ubiquitination | Uniprot | |
K192 | Ubiquitination | Uniprot | |
K208 | Ubiquitination | Uniprot | |
T254 | Phosphorylation | Uniprot | |
K260 | Ubiquitination | Uniprot | |
S324 | Phosphorylation | Uniprot | |
K325 | Ubiquitination | Uniprot | |
T327 | Phosphorylation | Uniprot | |
T328 | Phosphorylation | Uniprot | |
S396 | Phosphorylation | Uniprot | |
T420 | Phosphorylation | Uniprot | |
K423 | Ubiquitination | Uniprot | |
K433 | Ubiquitination | Uniprot | |
T440 | Phosphorylation | Uniprot | |
K443 | Ubiquitination | Uniprot | |
K460 | Ubiquitination | Uniprot | |
S490 | Phosphorylation | Uniprot | |
K553 | Ubiquitination | Uniprot | |
K556 | Ubiquitination | Uniprot | |
S560 | Phosphorylation | P06493 (CDK1) | Uniprot |
K572 | Ubiquitination | Uniprot | |
T581 | Phosphorylation | P06493 (CDK1) | Uniprot |
S586 | Phosphorylation | Uniprot | |
T589 | Phosphorylation | Uniprot | |
S595 | Phosphorylation | Uniprot | |
T599 | Phosphorylation | Uniprot | |
S607 | Phosphorylation | Uniprot | |
S614 | Phosphorylation | Uniprot |
Research Backgrounds
Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains.
Phosphorylated. Phosphorylation on Ser-560 occurs specifically during mitosis.
Cytoplasm>Cytoskeleton>Microtubule organizing center>Centrosome. Cytoplasm>Cytoskeleton>Spindle.
Note: Colocalizes with CDC27 to the centrosome at all stages of the cell cycle and to the mitotic spindle.
V-shaped homodimer. The mammalian APC/C is composed at least of 14 distinct subunits ANAPC1, ANAPC2, CDC27/APC3, ANAPC4, ANAPC5, CDC16/APC6, ANAPC7, CDC23/APC8, ANAPC10, ANAPC11, CDC26/APC12, ANAPC13, ANAPC15 and ANAPC16 that assemble into a complex of at least 19 chains with a combined molecular mass of around 1.2 MDa; APC/C interacts with FZR1 and FBXO5. Interacts with PPP5C and CDC20. Interacts with CDC26.
TPR repeats 1-7 mediate homodimerization, while the C-terminal TPR repeats bind to CDC26, burying its hydrophobic N-terminus.
Belongs to the APC6/CDC16 family.
Research Fields
· Cellular Processes > Cell growth and death > Cell cycle. (View pathway)
· Cellular Processes > Cell growth and death > Oocyte meiosis. (View pathway)
· Genetic Information Processing > Folding, sorting and degradation > Ubiquitin mediated proteolysis. (View pathway)
· Human Diseases > Infectious diseases: Viral > HTLV-I infection.
· Organismal Systems > Endocrine system > Progesterone-mediated oocyte maturation.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.