Product: CDC16/APC6 Antibody
Catalog: AF6608
Description: Rabbit polyclonal antibody to CDC16/APC6
Application: WB
Reactivity: Human, Mouse, Rat
Mol.Wt.: 72kD(Calculated).
Uniprot: Q13042
RRID: AB_2847332

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
CDC16/APC6 Antibody detects endogenous levels of total CDC16/APC6.
RRID:
AB_2847332
Cite Format: Affinity Biosciences Cat# AF6608, RRID:AB_2847332.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

ANAPC6; Anaphase promoting complex subunit 6; Anaphase-promoting complex subunit 6; Apc 6; APC6; CDC 16; CDC16 (cell division cycle 16 S. cerevisiae homolog); Cdc16; CDC16 homolog; CDC16 protein; CDC16_HUMAN; CDC16Hs; Cell division cycle 16; Cell division cycle 16 homolog; Cell division cycle protein 16 homolog; CUT9; Cyclosome subunit 6;

Immunogens

Immunogen:

A synthesized peptide derived from human CDC16/APC6.

Uniprot:
Gene(ID):
Sequence:
MNLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHALRSRKLDKLYEACRYLAARCHYAAKEHQQALDVLDMEEPINKRLFEKYLKDESGFKDPSSDWEMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQEEKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVDGLQENLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIGADIKDKLKCYDFDVHTMKTLKNIISPPWDFREFEVEKQTAEETGLTPLETSRKTPDSRPSLEETFEIEMNESDMMLETSMSDHST

PTMs - Q13042 As Substrate

Site PTM Type Enzyme
T50 Phosphorylation
Y53 Phosphorylation
K101 Ubiquitination
K106 Ubiquitination
K109 Ubiquitination
S112 Phosphorylation P06493 (CDK1) , P53350 (PLK1)
K115 Ubiquitination
K129 Ubiquitination
K138 Ubiquitination
K154 Ubiquitination
K192 Ubiquitination
K208 Ubiquitination
T254 Phosphorylation
K260 Ubiquitination
S324 Phosphorylation
K325 Ubiquitination
T327 Phosphorylation
T328 Phosphorylation
S396 Phosphorylation
T420 Phosphorylation
K423 Ubiquitination
K433 Ubiquitination
T440 Phosphorylation
K443 Ubiquitination
K460 Ubiquitination
S490 Phosphorylation
K553 Ubiquitination
K556 Ubiquitination
S560 Phosphorylation P06493 (CDK1)
K572 Ubiquitination
T581 Phosphorylation P06493 (CDK1)
S586 Phosphorylation
T589 Phosphorylation
S595 Phosphorylation
T599 Phosphorylation
S607 Phosphorylation
S614 Phosphorylation

Research Backgrounds

Function:

Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains.

PTMs:

Phosphorylated. Phosphorylation on Ser-560 occurs specifically during mitosis.

Subcellular Location:

Cytoplasm>Cytoskeleton>Microtubule organizing center>Centrosome. Cytoplasm>Cytoskeleton>Spindle.
Note: Colocalizes with CDC27 to the centrosome at all stages of the cell cycle and to the mitotic spindle.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

V-shaped homodimer. The mammalian APC/C is composed at least of 14 distinct subunits ANAPC1, ANAPC2, CDC27/APC3, ANAPC4, ANAPC5, CDC16/APC6, ANAPC7, CDC23/APC8, ANAPC10, ANAPC11, CDC26/APC12, ANAPC13, ANAPC15 and ANAPC16 that assemble into a complex of at least 19 chains with a combined molecular mass of around 1.2 MDa; APC/C interacts with FZR1 and FBXO5. Interacts with PPP5C and CDC20. Interacts with CDC26.

Family&Domains:

TPR repeats 1-7 mediate homodimerization, while the C-terminal TPR repeats bind to CDC26, burying its hydrophobic N-terminus.

Belongs to the APC6/CDC16 family.

Research Fields

· Cellular Processes > Cell growth and death > Cell cycle.   (View pathway)

· Cellular Processes > Cell growth and death > Oocyte meiosis.   (View pathway)

· Genetic Information Processing > Folding, sorting and degradation > Ubiquitin mediated proteolysis.   (View pathway)

· Human Diseases > Infectious diseases: Viral > HTLV-I infection.

· Organismal Systems > Endocrine system > Progesterone-mediated oocyte maturation.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.