Phospho-MLKL (Thr349) Antibody - #AF3904
Product: | Phospho-MLKL (Thr349) Antibody |
Catalog: | AF3904 |
Description: | Rabbit polyclonal antibody to Phospho-MLKL (Thr349) |
Application: | IHC IF/ICC |
Reactivity: | Human, Mouse |
Mol.Wt.: | 42kD(Calculated). |
Uniprot: | Q9D2Y6 |
RRID: | AB_2847218 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF3904, RRID:AB_2847218.
Immunogens
A synthesized peptide derived from mouse MLKL around the phosphorylation site of Thr349.
Expressed in all tissues tested, except striated muscle (at protein level). Expressed predominantly in the cerebral cortex, the hippocampus and the Purkinje cell layer of the brain. Intestine and kidney show also significant levels.
- Q9D2Y6 FBX25_MOUSE:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPFLGQDWRSPGWSWIKTEDGWKRCDPCSHELRSEDSQYTINHSIILNSGEEEIFNNECEYAAKKRKKEHFGNDTAAHSFYREKWIYVHKESTKERHGYCTLGEAFNRLDFSSAIQDIRRFTYVVKLLQLIAKSQLTSLSGVAQKNYFNILDKIVQKVLDDHQNPRLIKGLLQDLSSTLGILVRGVGKSVLVGNINIWICRLETVLSWQQQLQNLQVTKQVNTGLTLSDLPLHMLNNILYRFSDGWDIVTLGQVTPTLYMLSEDRRLWKRLCQYHFAEQQFCRHLILSEKGHIEWKLMYFTLQKYYPTKEQYGDTLHFCRHCSILFWKDSGHPCTAADPDSCFTPVSPEHFIDLFKF
Research Backgrounds
Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex. May play a role in accumulation of expanded polyglutamine (polyQ) protein huntingtin (HTT).
Nucleus.
Note: In the nucleus, associates with a specific and novel subnuclear dot-like structure. Colocalized with SKP1.
Expressed in all tissues tested, except striated muscle (at protein level). Expressed predominantly in the cerebral cortex, the hippocampus and the Purkinje cell layer of the brain. Intestine and kidney show also significant levels.
Part of a SCF (SKP1-cullin-F-box) protein ligase complex consisting of FBXO25, SKP1, CUL1 and RBX1. Interacts directly with SKP1 and CUL1. Interacts (via C-terminus) with beta-actin (via N-terminus) (By similarity).
The F-box is necessary for the interaction with SKP1.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.