Product: Phospho-p23 (Ser113) Antibody
Catalog: AF3794
Description: Rabbit polyclonal antibody to Phospho-p23 (Ser113)
Application: IF/ICC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 19kD(Calculated).
Uniprot: Q15185
RRID: AB_2847108

View similar products>>

   Size Price Inventory
 100ul $350 In stock
 200ul $450 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
Phospho-p23 (Ser113) Antibody detects endogenous levels of p23 only when phosphorylated at Ser113.
RRID:
AB_2847108
Cite Format: Affinity Biosciences Cat# AF3794, RRID:AB_2847108.
Conjugate:
Unconjugated.
Purification:
The antibody is from purified rabbit serum by affinity purification via sequential chromatography on phospho-peptide and non-phospho-peptide affinity columns.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Co chaperone p23; cPGES; Cytosolic prostaglandin E synthase; Cytosolic prostaglandin E2 synthase; Hsp90 co chaperone; Hsp90 co-chaperone; P23; Progesterone receptor complex; Progesterone receptor complex p23; Prostaglandin E synthase 3 (cytosolic); Prostaglandin E synthase 3; PTGES 3; PTGES3; Sid 3177; TEBP; TEBP_HUMAN; Telomerase binding protein p23; Telomerase-binding protein p23; Unactive progesterone receptor 23 kD;

Immunogens

Immunogen:

A synthesized peptide derived from human p23 around the phosphorylation site of Ser113.

Uniprot:
Gene(ID):
Sequence:
MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE

PTMs - Q15185 As Substrate

Site PTM Type Enzyme
K7 Acetylation
K7 Ubiquitination
Y14 Phosphorylation
K33 Acetylation
K33 Methylation
K33 Sumoylation
K33 Ubiquitination
K35 Acetylation
K35 Sumoylation
K35 Ubiquitination
S39 Phosphorylation
C40 S-Nitrosylation
S44 Phosphorylation
K48 Acetylation
K48 Methylation
K48 Ubiquitination
C58 S-Nitrosylation
S64 Phosphorylation
K65 Sumoylation
K65 Ubiquitination
K67 Ubiquitination
S72 Phosphorylation
C75 S-Nitrosylation
C76 S-Nitrosylation
K79 Sumoylation
K79 Ubiquitination
S82 Phosphorylation
S85 Phosphorylation
K91 Acetylation
K91 Ubiquitination
K95 Sumoylation
K95 Ubiquitination
S100 Phosphorylation
S113 Phosphorylation P68400 (CSNK2A1)
S118 Phosphorylation P68400 (CSNK2A1)
S124 Phosphorylation
S148 Phosphorylation
S151 Phosphorylation

Research Backgrounds

Function:

Cytosolic prostaglandin synthase that catalyzes the oxidoreduction of prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2). Molecular chaperone that localizes to genomic response elements in a hormone-dependent manner and disrupts receptor-mediated transcriptional activation, by promoting disassembly of transcriptional regulatory complexes. Facilitates HIF alpha proteins hydroxylation via interaction with EGLN1/PHD2, leading to recruit EGLN1/PHD2 to the HSP90 pathway.

Subcellular Location:

Cytoplasm.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Probably forms a complex composed of chaperones HSP90 and HSP70, co-chaperones STIP1/HOP, CDC37, PPP5C, PTGES3/p23, TSC1 and client protein TSC2. Binds to the progesterone receptor. Interacts with TERT; the interaction, together with HSP90AA1, is required for correct assembly and stabilization of the telomerase holoenzyme complex. Interacts (via PXLE motif) with EGLN1/PHD2, recruiting EGLN1/PHD2 to the HSP90 pathway to facilitate HIF alpha proteins hydroxylation. Interacts with HSP90AA1, FLCN, FNIP1 and FNIP2.

Family&Domains:

The PXLE motif mediates interaction with EGLN1/PHD2.

Belongs to the p23/wos2 family.

Research Fields

· Metabolism > Lipid metabolism > Arachidonic acid metabolism.

· Metabolism > Global and overview maps > Metabolic pathways.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.