Product: Phospho-RAB7L1 (Thr71) Antibody
Catalog: AF3777
Description: Rabbit polyclonal antibody to Phospho-RAB7L1 (Thr71)
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 23kD(Calculated).
Uniprot: O14966
RRID: AB_2847091

View similar products>>

   Size Price Inventory
 100ul $350 In stock
 200ul $450 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
IHC 1:50-1:200, IF/ICC 1:100-1:500, WB 1:500-1:2000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
Phospho-RAB7L1 (Thr71) Antibody detects endogenous levels of RAB7L1 only when phosphorylated at Rab29.
RRID:
AB_2847091
Cite Format: Affinity Biosciences Cat# AF3777, RRID:AB_2847091.
Conjugate:
Unconjugated.
Purification:
The antibody is from purified rabbit serum by affinity purification via sequential chromatography on phospho-peptide and non-phospho-peptide affinity columns.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

DKFZp686P1051; Rab 7 like protein 1; RAB 7L; Rab-7-like protein 1; RAB29; Rab7 like protein 1; RAB7 member RAS oncogene family like 1; RAB7L; RAB7L_HUMAN; Ras related protein Rab 7L1; Ras related protein Rab7L1; Ras-related protein Rab-29; Ras-related protein Rab-7L1;

Immunogens

Immunogen:

A synthesized peptide derived from human Rab7L1 around the phosphorylation site of Rab29.

Uniprot:
Gene(ID):
Expression:
O14966 RAB7L_HUMAN:

Ubiquitous.

Sequence:
MGSRDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQWSDYEIVRLQLWDIAGQERFTSMTRLYYRDASACVIMFDVTNATTFSNSQRWKQDLDSKLTLPNGEPVPCLLLANKCDLSPWAVSRDQIDRFSKENGFTGWTETSVKENKNINEAMRVLIEKMMRNSTEDIMSLSTQGDYINLQTKSSSWSCC

PTMs - O14966 As Substrate

Site PTM Type Enzyme
K20 Ubiquitination
S31 Phosphorylation
K34 Ubiquitination
S38 Phosphorylation
T39 Phosphorylation
S52 Phosphorylation
Y54 Phosphorylation
T71 Phosphorylation
S72 Phosphorylation
K103 Ubiquitination
S130 Phosphorylation
S135 Phosphorylation
K144 Ubiquitination
T149 Phosphorylation
T154 Phosphorylation
S155 Phosphorylation
K157 Ubiquitination
K160 Ubiquitination
K172 Ubiquitination
S185 Phosphorylation
T186 Phosphorylation
Y190 Phosphorylation

Research Backgrounds

Function:

The small GTPases Rab are key regulators in vesicle trafficking. Essential for maintaining the integrity of the endosome-trans-Golgi network structure (By similarity). Together with LRRK2, plays a role in the retrograde trafficking pathway for recycling proteins, such as mannose 6 phosphate receptor (M6PR), between lysosomes and the Golgi apparatus in a retromer-dependent manner. Recruits LRRK2 to the Golgi complex and stimulates LRRK2 kinase activity. Regulates neuronal process morphology in the intact central nervous system (CNS) (By similarity). May play a role in the formation of typhoid toxin transport intermediates during Salmonella enterica serovar Typhi (S.Typhi) epithelial cell infection.

PTMs:

In case of Salmonella enterica serovar Typhimurium (S.Typhimurium) infection, is proteolytically cleaved between Gly-41 and Val-42 by the GtgE viral protease encoded on the Gifsy-2 lysogen bacteriophage, which therefore prevents the recruitment of RAB29 to S.Typhimurium-containing vacuoles. In contrast, no proteolytically cleavage is detected in S.Typhi-infected cells.

Subcellular Location:

Cell membrane>Lipid-anchor>Cytoplasmic side. Cytoplasm. Cytoplasm>Perinuclear region. Golgi apparatus. Golgi apparatus>trans-Golgi network. Vacuole. Cytoplasm>Cytoskeleton.
Note: Colocalizes with LRRK2 along tubular structures emerging from Golgi apparatus (PubMed:29212815). Colocalizes with GM130 at the Golgi apparatus (PubMed:22042847). Colocalizes with dynamic tubules emerging from and retracting to the Golgi apparatus (PubMed:22042847). Colocalizes with TGN46 at the trans-Golgi network (TGN) (PubMed:24788816). In Salmonella enterica serovar Typhi (S.Typhi) infected epithelial cells, is recruited and colocalized with both S.Typhi-containing vacuoles and dynamic tubules as well as those emerging from the vacuole toward the cell periphery (PubMed:22042847).

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Ubiquitous.

Subunit Structure:

Interacts with LRRK2.

Family&Domains:

Belongs to the small GTPase superfamily. Rab family.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.