Phospho-CRYAB (Ser59) Antibody - #AF3754
Product: | Phospho-CRYAB (Ser59) Antibody |
Catalog: | AF3754 |
Description: | Rabbit polyclonal antibody to Phospho-CRYAB (Ser59) |
Application: | WB |
Reactivity: | Human, Mouse, Rat |
Mol.Wt.: | 20kD(Calculated). |
Uniprot: | P02511 |
RRID: | AB_2847068 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF3754, RRID:AB_2847068.
Fold/Unfold
AACRYA; Alpha B crystallin; Alpha crystallin B chain; Alpha(B)-crystallin; Alpha-crystallin B chain; CRYA2; Cryab; CRYAB_HUMAN; Crystallin alpha B; Crystallin alpha polypeptide 2; CTPP2; Heat shock 20 kD like protein; Heat shock protein beta 5; Heat shock protein beta-5; HspB5; Renal carcinoma antigen NY REN 27; Renal carcinoma antigen NY-REN-27; Rosenthal fiber component;
Immunogens
A synthesized peptide derived from human CRYAB around the phosphorylation site of Ser59.
Lens as well as other tissues (PubMed:838078, PubMed:2387586). Expressed in myocardial tissue (PubMed:28493373).
- P02511 CRYAB_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK
PTMs - P02511 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
M1 | Acetylation | Uniprot | |
S19 | Phosphorylation | Uniprot | |
S21 | Phosphorylation | Uniprot | |
R22 | Methylation | Uniprot | |
S43 | Phosphorylation | Uniprot | |
S45 | Phosphorylation | Uniprot | |
R50 | Methylation | Uniprot | |
S53 | Phosphorylation | Uniprot | |
S59 | Phosphorylation | Q16539 (MAPK14) | Uniprot |
R74 | Methylation | Uniprot | |
S76 | Phosphorylation | Uniprot | |
K82 | Ubiquitination | Uniprot | |
S85 | Phosphorylation | Uniprot | |
K90 | Acetylation | Uniprot | |
K90 | Ubiquitination | Uniprot | |
K92 | Acetylation | Uniprot | |
K92 | Ubiquitination | Uniprot | |
T132 | Phosphorylation | Uniprot | |
T134 | Phosphorylation | Uniprot | |
S135 | Phosphorylation | Uniprot | |
S136 | Phosphorylation | Uniprot | |
T144 | Phosphorylation | Uniprot | |
K150 | Ubiquitination | Uniprot | |
T158 | Phosphorylation | Uniprot | |
K166 | Acetylation | Uniprot | |
K166 | Ubiquitination | Uniprot | |
T170 | O-Glycosylation | Uniprot |
Research Backgrounds
May contribute to the transparency and refractive index of the lens. Has chaperone-like activity, preventing aggregation of various proteins under a wide range of stress conditions.
Cytoplasm. Nucleus.
Note: Translocates to the nucleus during heat shock and resides in sub-nuclear structures known as SC35 speckles or nuclear splicing speckles (PubMed:19464326). Localizes at the Z-bands and the intercalated disk in cardiomyocytes (PubMed:28493373).
Lens as well as other tissues. Expressed in myocardial tissue.
Heteropolymer composed of three CRYAA and one CRYAB subunits. Aggregates with homologous proteins, including the small heat shock protein HSPB1, to form large heteromeric complexes. Inter-subunit bridging via zinc ions enhances stability, which is crucial as there is no protein turn over in the lens. Interacts with HSPBAP1 and TTN/titin. Interacts with TMEM109. Interacts with DES; binds rapidly during early stages of DES filament assembly and a reduced binding seen in the later stages.
Belongs to the small heat shock protein (HSP20) family.
Research Fields
· Genetic Information Processing > Folding, sorting and degradation > Protein processing in endoplasmic reticulum. (View pathway)
· Organismal Systems > Aging > Longevity regulating pathway - multiple species. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.