Product: Phospho-CRYAB (Ser59) Antibody
Catalog: AF3754
Description: Rabbit polyclonal antibody to Phospho-CRYAB (Ser59)
Application: WB
Reactivity: Human, Mouse, Rat
Mol.Wt.: 20kD(Calculated).
Uniprot: P02511
RRID: AB_2847068

View similar products>>

   Size Price Inventory
 100ul $350 In stock
 200ul $450 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
Phospho-CRYAB (Ser59) Antibody detects endogenous levels of CRYAB only when phosphorylated at Ser59.
RRID:
AB_2847068
Cite Format: Affinity Biosciences Cat# AF3754, RRID:AB_2847068.
Conjugate:
Unconjugated.
Purification:
The antibody is from purified rabbit serum by affinity purification via sequential chromatography on phospho-peptide and non-phospho-peptide affinity columns.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

AACRYA; Alpha B crystallin; Alpha crystallin B chain; Alpha(B)-crystallin; Alpha-crystallin B chain; CRYA2; Cryab; CRYAB_HUMAN; Crystallin alpha B; Crystallin alpha polypeptide 2; CTPP2; Heat shock 20 kD like protein; Heat shock protein beta 5; Heat shock protein beta-5; HspB5; Renal carcinoma antigen NY REN 27; Renal carcinoma antigen NY-REN-27; Rosenthal fiber component;

Immunogens

Immunogen:

A synthesized peptide derived from human CRYAB around the phosphorylation site of Ser59.

Uniprot:
Gene(ID):
Expression:
P02511 CRYAB_HUMAN:

Lens as well as other tissues (PubMed:838078, PubMed:2387586). Expressed in myocardial tissue (PubMed:28493373).

Sequence:
MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK

PTMs - P02511 As Substrate

Site PTM Type Enzyme
M1 Acetylation
S19 Phosphorylation
S21 Phosphorylation
R22 Methylation
S43 Phosphorylation
S45 Phosphorylation
R50 Methylation
S53 Phosphorylation
S59 Phosphorylation Q16539 (MAPK14)
R74 Methylation
S76 Phosphorylation
K82 Ubiquitination
S85 Phosphorylation
K90 Acetylation
K90 Ubiquitination
K92 Acetylation
K92 Ubiquitination
T132 Phosphorylation
T134 Phosphorylation
S135 Phosphorylation
S136 Phosphorylation
T144 Phosphorylation
K150 Ubiquitination
T158 Phosphorylation
K166 Acetylation
K166 Ubiquitination
T170 O-Glycosylation

Research Backgrounds

Function:

May contribute to the transparency and refractive index of the lens. Has chaperone-like activity, preventing aggregation of various proteins under a wide range of stress conditions.

Subcellular Location:

Cytoplasm. Nucleus.
Note: Translocates to the nucleus during heat shock and resides in sub-nuclear structures known as SC35 speckles or nuclear splicing speckles (PubMed:19464326). Localizes at the Z-bands and the intercalated disk in cardiomyocytes (PubMed:28493373).

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Lens as well as other tissues. Expressed in myocardial tissue.

Subunit Structure:

Heteropolymer composed of three CRYAA and one CRYAB subunits. Aggregates with homologous proteins, including the small heat shock protein HSPB1, to form large heteromeric complexes. Inter-subunit bridging via zinc ions enhances stability, which is crucial as there is no protein turn over in the lens. Interacts with HSPBAP1 and TTN/titin. Interacts with TMEM109. Interacts with DES; binds rapidly during early stages of DES filament assembly and a reduced binding seen in the later stages.

Family&Domains:

Belongs to the small heat shock protein (HSP20) family.

Research Fields

· Genetic Information Processing > Folding, sorting and degradation > Protein processing in endoplasmic reticulum.   (View pathway)

· Organismal Systems > Aging > Longevity regulating pathway - multiple species.   (View pathway)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.